Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MQPPVPGPLGLLDPAEGLSRRKKTSLWFVGSLLLVSVLIVTVGLAATTRTENVTVGGYYPGIILGFGSFL      1 - 70
GIIGINLVENRRQMLVAAIVFISFGVVAAFCCAIVDGVFAAQHIEPRPLTTGRCQFYSSGVGYLYDVYQT     71 - 140
EVTCHSLDGKCQLKVRSNTCYCCDLYACGSAEPSPAYYEFIGVSGCQDVLHLYRLLWASAVLNVLGLFLG    141 - 210
IITAAVLGAFKDMVPLSQLAYGPAVPPQTLYNPAQQILAYAGFRLTPEPVPTCSSYPLPLQPCSRFPVAP    211 - 280
SSALASSEDLQPPSPSSSGSGLPGQAPPCYAPTYFPPGEKPPPYAP                            281 - 326
//

Text Mined References (4)

PMID Year Title
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.