Property Summary

NCBI Gene PubMed Count 13
PubMed Score 13.07
PubTator Score 18.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.594 0.000
breast carcinoma 1.700 0.001

Gene RIF (10)

PMID Text
25732110 provides the first evidence of ORAOV1 overexpression in esophageal squamous cell cancer and esophageal squamous intraepithelial neoplasia
24930674 the ORAOV1 gene is frequently amplified in esophageal squamous cell cancer
23318452 The ORAOV1 complex could prevent ROS-induced ribosomal damage, explaining why overexpression of ORAOV1 is so common in solid tumours
21993861 An oral cancer overexpressed 1 (ORAOV1) gene was identified as a probable target within the 11q13 amplicon in lymph node metastases from gastric adenocarcinoma.
21623924 overexpression of ORAOV1 in non-tumoral margin samples can occur in absence of amplification. weak correlation between ORAOV1 amplification and expression in OSSC suggests ORAOV1 expression can be regulated by mechanisms other than gene amplification.
20105337 ORAOV1 has an important role in regulating cell growth of cervical cancer HeLa cells through regulating the cell cycle and apoptosis.
19493886 In OSCC tissue samples, the expression frequency of ORAOV1-A (51.1%) was much higher than that in normal samples (10.5%). ORAOV1-A may play a functional role in the tumorigenesis of OSCC.
18688849 ORAOV1 plays pivotal roles in the growth and angiogenesis of oral squamous cell carcinoma.
17005439 data suggested potential roles in oral carcinogenesis and that TAOS1 might be involved earlier than EMS1. Both genes might be candidate biomarkers for diagnosis and prognosis in OSCC
12172009 High-resolution mapping of the 11q13 amplicon and identification of a gene that is amplified and overexpressed in oral cancer cells

AA Sequence

MAGSQDIFDAIVMADERFHGEGYREGYEEGSSLGVMEGRQHGTLHGAKIGSEIGCYQGFAFAWKCLLHSC      1 - 70
TTEKDSRKMKVLESLIGMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF        71 - 137
//

Text Mined References (16)

PMID Year Title
25732110 2015 ORAOV1 overexpression in esophageal squamous cell carcinoma and esophageal dysplasia: a possible biomarker of progression and poor prognosis in esophageal carcinoma.
24930674 2014 Frequent amplification of ORAOV1 gene in esophageal squamous cell cancer promotes an aggressive phenotype via proline metabolism and ROS production.
23318452 2014 The function of ORAOV1/LTO1, a gene that is overexpressed frequently in cancer: essential roles in the function and biogenesis of the ribosome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21993861 2012 ORAOV1 is a probable target within the 11q13.3 amplicon in lymph node metastases from gastric adenocarcinoma.
21623924 2012 ORAOV1 is amplified in oral squamous cell carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20453838 2010 Genome-wide association study identifies five new breast cancer susceptibility loci.
20105337 2010 Oral cancer overexpressed 1 (ORAOV1) regulates cell cycle and apoptosis in cervical cancer HeLa cells.
19493886 2009 ORAOV1-A correlates with poor differentiation in oral cancer.
More...