Property Summary

NCBI Gene PubMed Count 13
PubMed Score 14.31
PubTator Score 18.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 6.5e-11
breast carcinoma 1638 5.2e-04
Disease Target Count Z-score Confidence
Oral squamous cell carcinoma 11 3.634 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.700 5.2e-04
osteosarcoma -2.594 6.5e-11

Synonym

Accession Q8WV07 B2R4R2 Q8NFK0
Symbols TAOS1

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (10)

AA Sequence

MAGSQDIFDAIVMADERFHGEGYREGYEEGSSLGVMEGRQHGTLHGAKIGSEIGCYQGFAFAWKCLLHSC      1 - 70
TTEKDSRKMKVLESLIGMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF        71 - 137
//

Text Mined References (16)

PMID Year Title