Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.18
PubTator Score 3.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma 1.486 5.9e-03
Atopic dermatitis 1.800 2.0e-04
atypical teratoid / rhabdoid tumor 1.800 2.8e-04
Breast cancer 1.900 8.1e-10
glioblastoma 1.700 7.0e-05
group 3 medulloblastoma 3.000 2.7e-06
intraductal papillary-mucinous carcinoma... 1.900 1.8e-02
intraductal papillary-mucinous neoplasm ... 2.800 3.5e-05
invasive ductal carcinoma 1.200 4.6e-03
medulloblastoma, large-cell 2.600 3.0e-04
nasopharyngeal carcinoma 1.800 6.2e-05
non-small cell lung cancer 1.780 3.7e-17
osteosarcoma -2.593 7.3e-04
ovarian cancer 1.800 3.4e-03
pancreatic cancer 1.300 4.2e-04
pediatric high grade glioma 1.500 7.4e-04
primitive neuroectodermal tumor 2.400 3.2e-05
psoriasis 1.200 2.0e-26

Synonym

Accession Q8WUY9 A8K3R9 B4DUT4 Q86WJ3 Q8IZY6 Q9NUN3 Q9NW57
Symbols XTP1
BRCC3

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MEHRIVGPGPYRATRLWNETVELFRAKMPLRKHRCRFKSYEHCFTAAEAVDWLHELLRCSQNFGPEVTRK      1 - 70
QTVQLLKKFLKNHVIEDIKGKWGEEDFEDNRHLYRFPPSSPLKPYPKKPPNQKDVIKFPEWNDLPPGTSQ     71 - 140
ENIPVRPVVMNSEMWYKRHSIAIGEVPACRLVHRRQLTEANVEEIWKSMTLSYLQKILGLDSLEEVLDVK    141 - 210
LVNSKFIIHNVYSVSKQGVVILDDKSKELPHWVLSAMKCLANWPNCSDLKQPMYLGFEKDVFKTIADYYG    211 - 280
HLKEPLLTFHLFDAFVSVLGLLQKEKVAVEAFQICCLLLPPENRRKLQLLMRMMARICLNKEMPPLCDGF    281 - 350
GTRTLMVQTFSRCILCSKDEVDLDELLAARLVTFLMDNYQEILKVPLALQTSIEERVAHLRRVQIKYPGA    351 - 420
DMDITLSAPSFCRQISPEEFEYQRSYGSQEPLAALLEEVITDAKLSNKEKKKKLKQFQKSYPEVYQERFP    421 - 490
TPESAALLFPEKPKPKPQLLMWALKKPFQPFQRTRSFRM                                   491 - 529
//

Text Mined References (11)

PMID Year Title