Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.71
PubTator Score 3.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.65649050290162E-158
non-small cell lung cancer 2798 3.69083051919704E-17
Breast cancer 3099 8.08817234434231E-10
atypical teratoid/rhabdoid tumor 1095 2.16079727479848E-6
group 3 medulloblastoma 2254 2.66642458506202E-6
primitive neuroectodermal tumor 3031 3.15682784071534E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.53400198901782E-5
nasopharyngeal carcinoma 1056 6.18093930718907E-5
glioblastoma 5572 7.03737519809096E-5
Atopic dermatitis 944 2.0195449792496E-4
medulloblastoma, large-cell 6234 2.95941185671972E-4
pancreatic cancer 2300 4.16353215946772E-4
osteosarcoma 7933 7.30426379250786E-4
pediatric high grade glioma 2712 7.42263740773755E-4
ovarian cancer 8492 0.00337616272878753
invasive ductal carcinoma 2950 0.0045504812312302
adrenocortical carcinoma 1427 0.00591389236678551
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0179125343904257

Expression

Synonym

Accession Q8WUY9 A8K3R9 B4DUT4 Q86WJ3 Q8IZY6 Q9NUN3 Q9NW57
Symbols XTP1
BRCC3

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Opossum OMA Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (4)

PMID Text
25704760 Pitx2-mediated repression of Depdc1b expression contributes to the regulation of multiple molecular pathways, such as Rho GTPase signaling.
25091805 proliferation was linked to a novel DEPDC1B-Rac1-ERK1/2 signaling axis in oral cancer cell lines.
24971537 Taken together, our data demonstrate that DEPDC1B might confer metastasis-related malignant phenotype to NSCLC in a Wnt/beta-catenin dependent manner, providing new insights in developing novel anti-NSCLC strategies.
20923822 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEHRIVGPGPYRATRLWNETVELFRAKMPLRKHRCRFKSYEHCFTAAEAVDWLHELLRCSQNFGPEVTRK      1 - 70
QTVQLLKKFLKNHVIEDIKGKWGEEDFEDNRHLYRFPPSSPLKPYPKKPPNQKDVIKFPEWNDLPPGTSQ     71 - 140
ENIPVRPVVMNSEMWYKRHSIAIGEVPACRLVHRRQLTEANVEEIWKSMTLSYLQKILGLDSLEEVLDVK    141 - 210
LVNSKFIIHNVYSVSKQGVVILDDKSKELPHWVLSAMKCLANWPNCSDLKQPMYLGFEKDVFKTIADYYG    211 - 280
HLKEPLLTFHLFDAFVSVLGLLQKEKVAVEAFQICCLLLPPENRRKLQLLMRMMARICLNKEMPPLCDGF    281 - 350
GTRTLMVQTFSRCILCSKDEVDLDELLAARLVTFLMDNYQEILKVPLALQTSIEERVAHLRRVQIKYPGA    351 - 420
DMDITLSAPSFCRQISPEEFEYQRSYGSQEPLAALLEEVITDAKLSNKEKKKKLKQFQKSYPEVYQERFP    421 - 490
TPESAALLFPEKPKPKPQLLMWALKKPFQPFQRTRSFRM                                   491 - 529
//

Text Mined References (11)

PMID Year Title
25704760 2015 Identification of the GTPase-activating protein DEP domain containing 1B (DEPDC1B) as a transcriptional target of Pitx2.
25458010 2014 DEPDC1B coordinates de-adhesion events and cell-cycle progression at mitosis.
25091805 2014 A putative novel protein, DEPDC1B, is overexpressed in oral cancer patients, and enhanced anchorage-independent growth in oral cancer cells that is mediated by Rac1 and ERK.
24971537 2014 DEPDC1B enhances migration and invasion of non-small cell lung cancer cells via activating Wnt/?-catenin signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20923822 2010 Radiation pharmacogenomics: a genome-wide association approach to identify radiation response biomarkers using human lymphoblastoid cell lines.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...