Property Summary

NCBI Gene PubMed Count 7
Grant Count 4
R01 Count 4
Funding $156,299.87
PubMed Score 5.71
PubTator Score 3.45

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
25704760 Pitx2-mediated repression of Depdc1b expression contributes to the regulation of multiple molecular pathways, such as Rho GTPase signaling.
25091805 proliferation was linked to a novel DEPDC1B-Rac1-ERK1/2 signaling axis in oral cancer cell lines.
24971537 Taken together, our data demonstrate that DEPDC1B might confer metastasis-related malignant phenotype to NSCLC in a Wnt/beta-catenin dependent manner, providing new insights in developing novel anti-NSCLC strategies.
20923822 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEHRIVGPGPYRATRLWNETVELFRAKMPLRKHRCRFKSYEHCFTAAEAVDWLHELLRCSQNFGPEVTRK      1 - 70
QTVQLLKKFLKNHVIEDIKGKWGEEDFEDNRHLYRFPPSSPLKPYPKKPPNQKDVIKFPEWNDLPPGTSQ     71 - 140
ENIPVRPVVMNSEMWYKRHSIAIGEVPACRLVHRRQLTEANVEEIWKSMTLSYLQKILGLDSLEEVLDVK    141 - 210
LVNSKFIIHNVYSVSKQGVVILDDKSKELPHWVLSAMKCLANWPNCSDLKQPMYLGFEKDVFKTIADYYG    211 - 280
HLKEPLLTFHLFDAFVSVLGLLQKEKVAVEAFQICCLLLPPENRRKLQLLMRMMARICLNKEMPPLCDGF    281 - 350
GTRTLMVQTFSRCILCSKDEVDLDELLAARLVTFLMDNYQEILKVPLALQTSIEERVAHLRRVQIKYPGA    351 - 420
DMDITLSAPSFCRQISPEEFEYQRSYGSQEPLAALLEEVITDAKLSNKEKKKKLKQFQKSYPEVYQERFP    421 - 490
TPESAALLFPEKPKPKPQLLMWALKKPFQPFQRTRSFRM                                   491 - 529
//

Text Mined References (11)

PMID Year Title
25704760 2015 Identification of the GTPase-activating protein DEP domain containing 1B (DEPDC1B) as a transcriptional target of Pitx2.
25458010 2014 DEPDC1B coordinates de-adhesion events and cell-cycle progression at mitosis.
25091805 2014 A putative novel protein, DEPDC1B, is overexpressed in oral cancer patients, and enhanced anchorage-independent growth in oral cancer cells that is mediated by Rac1 and ERK.
24971537 2014 DEPDC1B enhances migration and invasion of non-small cell lung cancer cells via activating Wnt/?-catenin signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20923822 2010 Radiation pharmacogenomics: a genome-wide association approach to identify radiation response biomarkers using human lymphoblastoid cell lines.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...