Property Summary

NCBI Gene PubMed Count 7
PubMed Score 8.01
PubTator Score 4.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma 1.113 1.9e-03
fibroadenoma 1.100 2.6e-03
invasive ductal carcinoma 1.400 1.6e-02
ovarian cancer 1.400 9.1e-05
pituitary cancer 1.400 2.0e-05

Gene RIF (1)

AA Sequence

MAPSHLSVREMREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAAASSGLRFVLASFALALLLPV      1 - 70
FLAVAAVKLGLRARWGSLPPPGGLGGPWVAVRGSGDVCGVLALAPGTNAGDGARVTRLSVSRWHRRRGVG     71 - 140
RRLLAFAEARARAWAGGMGEPRARLVVPVAVAAWGVGGMLEGCGYQAEGGWGCLGYTLVREFSKDL        141 - 206
//

Text Mined References (8)

PMID Year Title