Property Summary

NCBI Gene PubMed Count 7
Grant Count 6
R01 Count 5
Funding $316,858.5
PubMed Score 5.61
PubTator Score 4.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma 1.113 0.002
fibroadenoma 1.100 0.003
invasive ductal carcinoma 1.400 0.016
ovarian cancer 1.400 0.000
pituitary cancer 1.400 0.000

Gene RIF (1)

PMID Text
19807691 Results indicated that NAT8L, but not NAT14, catalysed the synthesis of NAA from L-aspartate and acetyl-CoA.

AA Sequence

MAPSHLSVREMREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAAASSGLRFVLASFALALLLPV      1 - 70
FLAVAAVKLGLRARWGSLPPPGGLGGPWVAVRGSGDVCGVLALAPGTNAGDGARVTRLSVSRWHRRRGVG     71 - 140
RRLLAFAEARARAWAGGMGEPRARLVVPVAVAAWGVGGMLEGCGYQAEGGWGCLGYTLVREFSKDL        141 - 206
//

Text Mined References (8)

PMID Year Title
19807691 2009 Molecular identification of aspartate N-acetyltransferase and its mutation in hypoacetylaspartia.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11779635 2001 Genomic structure and regulation of a novel human gene, Klp1.
10873651 2000 Cloning of a coproporphyrinogen oxidase promoter regulatory element binding protein.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.