Property Summary

NCBI Gene PubMed Count 30
PubMed Score 12.32
PubTator Score 13.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Kidney cancer 2613 0.0 0.7
Liver cancer 604 0.0 0.8
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.9
Disease Target Count Z-score Confidence
Leiomyosarcoma 24 3.772 1.9
Parathyroid carcinoma 7 3.212 1.6

Expression

  Differential Expression (35)

Disease log2 FC p
acute quadriplegic myopathy 2.721 2.3e-08
aldosterone-producing adenoma -1.167 3.0e-02
Amyotrophic lateral sclerosis 1.452 5.3e-05
astrocytic glioma 1.600 2.3e-02
Astrocytoma, Pilocytic 1.100 3.5e-02
Atopic dermatitis -1.700 1.6e-04
atypical teratoid / rhabdoid tumor -2.100 3.9e-04
autosomal dominant Emery-Dreifuss muscul... 2.033 4.3e-04
Becker muscular dystrophy 2.001 3.6e-05
colon cancer -3.400 2.4e-03
diabetes mellitus -1.600 4.1e-02
Down syndrome 1.400 1.5e-03
Duchenne muscular dystrophy 2.308 4.2e-10
ependymoma -1.500 5.6e-05
fascioscapulohumeral muscular dystrophy 1.295 1.1e-03
glioblastoma -1.100 5.5e-03
group 3 medulloblastoma -2.700 1.1e-06
intraductal papillary-mucinous carcinoma... 2.800 3.3e-02
invasive ductal carcinoma -1.500 3.0e-02
juvenile dermatomyositis 1.204 3.6e-04
limb girdle muscular dystrophy 2A 2.286 1.3e-07
lung adenocarcinoma -1.100 2.7e-04
lung cancer -1.800 6.3e-03
lung carcinoma -1.300 6.8e-08
malignant mesothelioma -7.200 3.1e-10
medulloblastoma, large-cell -3.700 1.4e-05
nasopharyngeal carcinoma -1.100 5.0e-03
oligodendroglioma 1.400 1.5e-02
ovarian cancer -1.200 1.2e-02
Pick disease -1.300 7.9e-04
pituitary cancer -2.500 3.1e-06
primitive neuroectodermal tumor -2.500 4.3e-03
progressive supranuclear palsy -1.800 2.4e-02
psoriasis -1.600 7.0e-06
ulcerative colitis 1.200 3.1e-03

Gene RIF (16)

AA Sequence

MEEFLQRAKSKLNRSKRLEKVHVVIGPKSCDLDSLISTFTYAYFLDKVSPPGVLCLPVLNIPRTEFNYFT      1 - 70
ETRFILEELNISESFHIFRDEINLHQLNDEGKLSITLVGSSVLASEDKTLESAVVKVINPVEQSDANVEF     71 - 140
RESSSSLVLKEILQEAPELITEQLAHRLRGSILFKWMTMESEKISEKQEEILSILEEKFPNLPPREDIIN    141 - 210
VLQETQFSAQGLSIEQTMLKDLKELSDGEIKVAISTVSMNLENCLFHSNITSDLKAFTDKFGFDVLILFS    211 - 280
SYLSEEQQPRRQIAVYSENMELCSQICCELEECQNPCLELEPFDCGCDEILVYQQEDPSVTCDQVVLVVK    281 - 350
EVINRRCPEMVSNSRTSSTEAVAGSAPLSQGSSGIMELYGSDIEPQPSSVNFIENPPDLNDSNQAQVDAN    351 - 420
VDLVSPDSGLATIRSSRSSKESSVFLSDDSPVGEGAGPHHTLLPGLDSYSPIPEGAVAEEHAWSGEHGEH    421 - 490
FDLFNFDPAPMASGQSQQSSHSADYSPADDFFPNSDLSEGQLPAGPEGLDGMGTNMSNYSSSSLLSGAGK    491 - 560
DSLVEHDEEFVQRQDSPRDNSERNLSLTDFVGDESPSPERLKNTGKRIPPTPMNSLVESSPSTEEPASLY    561 - 630
TEDMTQKATDTGHMGPPQTHARCSSWWGGLEIDSKNIADAWSSSEQESVFQSPESWKEHKPSSIDRRASD    631 - 700
SVFQPKSLEFTKSGPWESEFGQPELGSNDIQDKNEESLPFQNLPMEKSPLPNTSPQGTNHLIEDFASLWH    701 - 770
SGRSPTAMPEPWGNPTDDGEPAAVAPFPAWSAFGKEDHDEALKNTWNLHPTSSKTPSVRDPNEWAMAKSG    771 - 840
FAFSSSELLDNSPSEINNEAAPEIWGKKNNDSRDHIFAPGNPSSDLDHTWTNSKPPKEDQNGLVDPKTRG    841 - 910
KVYEKVDSWNLFEENMKKGGSDVLVPWEDSFLSYKCSDYSASNLGEDSVPSPLDTNYSTSDSYTSPTFAG    911 - 980
DEKETEHKPFAKEEGFESKDGNSTAEETDIPPQSLQQSSRNRISSGPGNLDMWASPHTDNSSEINTTHNL    981 - 1050
DENELKTEHTDGKNISMEDDVGESSQSSYDDPSMMQLYNETNRQLTLLHSSTNSRQTAPDSLDLWNRVIL   1051 - 1120
EDTQSTATISDMDNDLDWDDCSGGAAIPSDGQTEGYMAEGSEPETRFTVRQLEPWGLEYQEANQVDWELP   1121 - 1190
ASDEHTKDSAPSEHHTLNEKSGQLIANSIWDSVMRDKDMSSFMLPGSSHITDSEQRELPPEIPSHSANVK   1191 - 1260
DTHSPDAPAASGTSESEALISHLDKQDTERETLQSDAASLATRLENPGYFPHPDPWKGHGDGQSESEKEA   1261 - 1330
QGATDRGHLDEEEVIASGVENASGISEKGQSDQELSSLVASEHQEICIKSGKISSLAVTFSPQTEEPEEV   1331 - 1400
LEYEEGSYNLDSRDVQTGMSADNLQPKDTHEKHLMSQRNSGETTETSDGMNFTKYVSVPEKDLEKTEECN   1401 - 1470
FLEPENVGGGPPHRVPRSLDFGDVPIDSDVHVSSTCSEITKNLDVKGSENSLPGAGSSGNFDRDTISSEY   1471 - 1540
THSSASSPELNDSSVALSSWGQQPSSGYQEENQGNWSEQNHQESELITTDGQVEIVTKVKDLEKNRINEF   1541 - 1610
EKSFDRKTPTFLEIWNDSVDGDSFSSLSSPETGKYSEHSGTHQESNLIASYQEKNEHDISATVQPEDARV   1611 - 1680
ISTSSGSDDDSVGGEESIEEEIQVANCHVAEDESRAWDSLNESNKFLVTADPKSENIYDYLDSSEPAENE   1681 - 1750
NKSNPFCDNQQSSPDPWTFSPLTETEMQITAVEKEKRSSPETGTTGDVAWQISPKASFPKNEDNSQLEML   1751 - 1820
GFSADSTEWWKASPQEGRLIESPFERELSDSSGVLEINSSVHQNASPWGVPVQGDIEPVETHYTNPFSDN   1821 - 1890
HQSPFLEGNGKNSHEQLWNIQPRQPDPDADKFSQLVKLDQIKEKDSREQTFVSAAGDELTPETPTQEQCQ   1891 - 1960
DTMLPVCDHPDTAFTHAEENSCVTSNVSTNEGQETNQWEQEKSYLGEMTNSSIATENFPAVSSPTQLIMK   1961 - 2030
PGSEWDGSTPSEDSRGTFVPDILHGNFQEGGQLASAAPDLWIDAKKPFSLKADGENPDILTHCEHDSNSQ   2031 - 2100
ASDSPDICHDSEAKQETEKHLSACMGPEVESSELCLTEPEIDEEPIYEPGREFVPSNAELDSENATVLPP   2101 - 2170
IGYQADIKGSSQPASHKGSPEPSEINGDNSTGLQVSEKGASPDMAPILEPVDRRIPRIENVATSIFVTHQ   2171 - 2240
EPTPEGDGSWISDSFSPESQPGARALFDGDPHLSTENPALVPDALLASDTCLDISEAAFDHSFSDASGLN   2241 - 2310
TSTGTIDDMSKLTLSEGHPETPVDGDLGKQDICSSEASWGDFEYDVMGQNIDEDLLREPEHFLYGGDPPL   2311 - 2380
EEDSLKQSLAPYTPPFDLSYLTEPAQSAETIEEAGSPEDESLGCRAAEIVLSALPDRRSEGNQAETKNRL   2381 - 2450
PGSQLAVLHIREDPESVYLPVGAGSNILSPSNVDWEVETDNSDLPAGGDIGPPNGASKEISELEEEKTIP   2451 - 2520
TKEPEQIKSEYKEERCTEKNEDRHALHMDYILVNREENSHSKPETCEERESIAELELYVGSKETGLQGTQ   2521 - 2590
LASFPDTCQPASLNERKGLSAEKMSSKSDTRSSFESPAQDQSWMFLGHSEVGDPSLDARDSGPGWSGKTV   2591 - 2660
EPFSELGLGEGPQLQILEEMKPLESLALEEASGPVSQSQKSKSRGRAGPDAVTLQAVTHDNEWEMLSPQP   2661 - 2730
VQKNMIPDTEMEEETEFLELGTRISRPNGLLSEDVGMDIPFEEGVLSPSAADMRPEPPNSLDLNDTHPRR   2731 - 2800
IKLTAPNINLSLDQSEGSILSDDNLDSPDEIDINVDELDTPDEADSFEYTGHDPTANKDSGQESESIPEY   2801 - 2870
TAEEEREDNRLWRTVVIGEQEQRIDMKVIEPYRRVISHGGYYGDGLNAIIVFAACFLPDSSRADYHYVME   2871 - 2940
NLFLYVISTLELMVAEDYMIVYLNGATPRRRMPGLGWMKKCYQMIDRRLRKNLKSFIIVHPSWFIRTILA   2941 - 3010
VTRPFISSKFSSKIKYVNSLSELSGLIPMDCIHIPESIIKLDEELREASEAAKTSCLYNDPEMSSMEKDI   3011 - 3080
DLKLKEKP                                                                 3081 - 3088
//

Text Mined References (34)

PMID Year Title