Property Summary

NCBI Gene PubMed Count 29
PubMed Score 11.19
PubTator Score 13.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
26080435 Results show prostate cancer antigen 3 (PCA3) as a dominant-negative oncogene and PRUNE2 protein as an unrecognized tumor suppressor gene in prostate cancer.
25611382 BMCC1 negatively regulates phosphorylation pathway of AKT, resulted in apoptosis and the BNIP2 homology region of BMCC1 interacts with BCL2.
25387265 recurrent germ line and somatic mutations in PRUNE2 were found in parathyroid carcinoma and computationally predicted to be deleterious; in addition, recurrent mutations in kinase genes related to cell migration and invasion were found.
24040105 BMCC1 is an AP-2 associated endosomal protein in prostate cancer cells.
23059019 We showed that Olfaxin, a novel Prune2 isoform contains a BCH motif and localizes predominantly to the synaptic cytosol in the olfactory bulb and layer Ia of the piriform cortex.
22967466 PRUNE2 expression is correlated with the survival of leiomyosarcoma patients. Non-coding RNA PCA3 has a significant positive correlation with PRUNE2 and may play an important role in the pathogenesis of leiomyosarcoma.
21234814 The nerve tissue-specific and post-development expression of PRUNE2/Prune2 suggests that PRUNE2 may contribute to the maintenance of mature nervous systems.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19760627 The androgen regulation of PRUNE2 expression in prostate cancer cells was found to not be of any diagnostic value.
More...

AA Sequence

MEEFLQRAKSKLNRSKRLEKVHVVIGPKSCDLDSLISTFTYAYFLDKVSPPGVLCLPVLNIPRTEFNYFT      1 - 70
ETRFILEELNISESFHIFRDEINLHQLNDEGKLSITLVGSSVLASEDKTLESAVVKVINPVEQSDANVEF     71 - 140
RESSSSLVLKEILQEAPELITEQLAHRLRGSILFKWMTMESEKISEKQEEILSILEEKFPNLPPREDIIN    141 - 210
VLQETQFSAQGLSIEQTMLKDLKELSDGEIKVAISTVSMNLENCLFHSNITSDLKAFTDKFGFDVLILFS    211 - 280
SYLSEEQQPRRQIAVYSENMELCSQICCELEECQNPCLELEPFDCGCDEILVYQQEDPSVTCDQVVLVVK    281 - 350
EVINRRCPEMVSNSRTSSTEAVAGSAPLSQGSSGIMELYGSDIEPQPSSVNFIENPPDLNDSNQAQVDAN    351 - 420
VDLVSPDSGLATIRSSRSSKESSVFLSDDSPVGEGAGPHHTLLPGLDSYSPIPEGAVAEEHAWSGEHGEH    421 - 490
FDLFNFDPAPMASGQSQQSSHSADYSPADDFFPNSDLSEGQLPAGPEGLDGMGTNMSNYSSSSLLSGAGK    491 - 560
DSLVEHDEEFVQRQDSPRDNSERNLSLTDFVGDESPSPERLKNTGKRIPPTPMNSLVESSPSTEEPASLY    561 - 630
TEDMTQKATDTGHMGPPQTHARCSSWWGGLEIDSKNIADAWSSSEQESVFQSPESWKEHKPSSIDRRASD    631 - 700
SVFQPKSLEFTKSGPWESEFGQPELGSNDIQDKNEESLPFQNLPMEKSPLPNTSPQGTNHLIEDFASLWH    701 - 770
SGRSPTAMPEPWGNPTDDGEPAAVAPFPAWSAFGKEDHDEALKNTWNLHPTSSKTPSVRDPNEWAMAKSG    771 - 840
FAFSSSELLDNSPSEINNEAAPEIWGKKNNDSRDHIFAPGNPSSDLDHTWTNSKPPKEDQNGLVDPKTRG    841 - 910
KVYEKVDSWNLFEENMKKGGSDVLVPWEDSFLSYKCSDYSASNLGEDSVPSPLDTNYSTSDSYTSPTFAG    911 - 980
DEKETEHKPFAKEEGFESKDGNSTAEETDIPPQSLQQSSRNRISSGPGNLDMWASPHTDNSSEINTTHNL    981 - 1050
DENELKTEHTDGKNISMEDDVGESSQSSYDDPSMMQLYNETNRQLTLLHSSTNSRQTAPDSLDLWNRVIL   1051 - 1120
EDTQSTATISDMDNDLDWDDCSGGAAIPSDGQTEGYMAEGSEPETRFTVRQLEPWGLEYQEANQVDWELP   1121 - 1190
ASDEHTKDSAPSEHHTLNEKSGQLIANSIWDSVMRDKDMSSFMLPGSSHITDSEQRELPPEIPSHSANVK   1191 - 1260
DTHSPDAPAASGTSESEALISHLDKQDTERETLQSDAASLATRLENPGYFPHPDPWKGHGDGQSESEKEA   1261 - 1330
QGATDRGHLDEEEVIASGVENASGISEKGQSDQELSSLVASEHQEICIKSGKISSLAVTFSPQTEEPEEV   1331 - 1400
LEYEEGSYNLDSRDVQTGMSADNLQPKDTHEKHLMSQRNSGETTETSDGMNFTKYVSVPEKDLEKTEECN   1401 - 1470
FLEPENVGGGPPHRVPRSLDFGDVPIDSDVHVSSTCSEITKNLDVKGSENSLPGAGSSGNFDRDTISSEY   1471 - 1540
THSSASSPELNDSSVALSSWGQQPSSGYQEENQGNWSEQNHQESELITTDGQVEIVTKVKDLEKNRINEF   1541 - 1610
EKSFDRKTPTFLEIWNDSVDGDSFSSLSSPETGKYSEHSGTHQESNLIASYQEKNEHDISATVQPEDARV   1611 - 1680
ISTSSGSDDDSVGGEESIEEEIQVANCHVAEDESRAWDSLNESNKFLVTADPKSENIYDYLDSSEPAENE   1681 - 1750
NKSNPFCDNQQSSPDPWTFSPLTETEMQITAVEKEKRSSPETGTTGDVAWQISPKASFPKNEDNSQLEML   1751 - 1820
GFSADSTEWWKASPQEGRLIESPFERELSDSSGVLEINSSVHQNASPWGVPVQGDIEPVETHYTNPFSDN   1821 - 1890
HQSPFLEGNGKNSHEQLWNIQPRQPDPDADKFSQLVKLDQIKEKDSREQTFVSAAGDELTPETPTQEQCQ   1891 - 1960
DTMLPVCDHPDTAFTHAEENSCVTSNVSTNEGQETNQWEQEKSYLGEMTNSSIATENFPAVSSPTQLIMK   1961 - 2030
PGSEWDGSTPSEDSRGTFVPDILHGNFQEGGQLASAAPDLWIDAKKPFSLKADGENPDILTHCEHDSNSQ   2031 - 2100
ASDSPDICHDSEAKQETEKHLSACMGPEVESSELCLTEPEIDEEPIYEPGREFVPSNAELDSENATVLPP   2101 - 2170
IGYQADIKGSSQPASHKGSPEPSEINGDNSTGLQVSEKGASPDMAPILEPVDRRIPRIENVATSIFVTHQ   2171 - 2240
EPTPEGDGSWISDSFSPESQPGARALFDGDPHLSTENPALVPDALLASDTCLDISEAAFDHSFSDASGLN   2241 - 2310
TSTGTIDDMSKLTLSEGHPETPVDGDLGKQDICSSEASWGDFEYDVMGQNIDEDLLREPEHFLYGGDPPL   2311 - 2380
EEDSLKQSLAPYTPPFDLSYLTEPAQSAETIEEAGSPEDESLGCRAAEIVLSALPDRRSEGNQAETKNRL   2381 - 2450
PGSQLAVLHIREDPESVYLPVGAGSNILSPSNVDWEVETDNSDLPAGGDIGPPNGASKEISELEEEKTIP   2451 - 2520
TKEPEQIKSEYKEERCTEKNEDRHALHMDYILVNREENSHSKPETCEERESIAELELYVGSKETGLQGTQ   2521 - 2590
LASFPDTCQPASLNERKGLSAEKMSSKSDTRSSFESPAQDQSWMFLGHSEVGDPSLDARDSGPGWSGKTV   2591 - 2660
EPFSELGLGEGPQLQILEEMKPLESLALEEASGPVSQSQKSKSRGRAGPDAVTLQAVTHDNEWEMLSPQP   2661 - 2730
VQKNMIPDTEMEEETEFLELGTRISRPNGLLSEDVGMDIPFEEGVLSPSAADMRPEPPNSLDLNDTHPRR   2731 - 2800
IKLTAPNINLSLDQSEGSILSDDNLDSPDEIDINVDELDTPDEADSFEYTGHDPTANKDSGQESESIPEY   2801 - 2870
TAEEEREDNRLWRTVVIGEQEQRIDMKVIEPYRRVISHGGYYGDGLNAIIVFAACFLPDSSRADYHYVME   2871 - 2940
NLFLYVISTLELMVAEDYMIVYLNGATPRRRMPGLGWMKKCYQMIDRRLRKNLKSFIIVHPSWFIRTILA   2941 - 3010
VTRPFISSKFSSKIKYVNSLSELSGLIPMDCIHIPESIIKLDEELREASEAAKTSCLYNDPEMSSMEKDI   3011 - 3080
DLKLKEKP                                                                 3081 - 3088
//

Text Mined References (33)

PMID Year Title
26080435 2015 PRUNE2 is a human prostate cancer suppressor regulated by the intronic long noncoding RNA PCA3.
25611382 2015 BMCC1, which is an interacting partner of BCL2, attenuates AKT activity, accompanied by apoptosis.
25392181 2015 Identification and diagnostic performance of a small RNA within the PCA3 and BMCC1 gene locus that potentially targets mRNA.
25387265 2015 Whole-exome sequencing studies of parathyroid carcinomas reveal novel PRUNE2 mutations, distinctive mutational spectra related to APOBEC-catalyzed DNA mutagenesis and mutational enrichment in kinases associated with cell migration and invasion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24040105 2013 BMCC1 is an AP-2 associated endosomal protein in prostate cancer cells.
23246912 2013 Bmcc1s interacts with the phosphate-activated glutaminase in the brain.
23059019 2012 Olfaxin as a novel Prune2 isoform predominantly expressed in olfactory system.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22967466 2012 [Expression of PRUNE2 mRNA and its positive correlation with non-coding RNA PCA3 in leiomyosarcoma].
More...