Property Summary

NCBI Gene PubMed Count 4
PubMed Score 86.46
PubTator Score 8.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 8.33939654001595E-8
interstitial cystitis 2299 2.1883519511162E-5
psoriasis 6685 1.73229238153151E-4
ovarian cancer 8492 1.95203056308689E-4
Disease Target Count Z-score Confidence
Discharging ear 1 5.42 2.7
Enophthalmos 12 3.228 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.800 0.000
psoriasis 1.600 0.000
interstitial cystitis -1.700 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q8WUY1 B2RDN6 Q8NBN2 Q9NYI2
Symbols DSCD75
C8orf55

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
22082156 Knockdown of thioesterase superfamily member 6 (THEM6) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MLGLLVALLALGLAVFALLDVWYLVRLPCAVLRARLLQPRVRDLLAEQRFPGRVLPSDLDLLLHMNNARY      1 - 70
LREADFARVAHLTRCGVLGALRELRAHTVLAASCARHRRSLRLLEPFEVRTRLLGWDDRAFYLEARFVSL     71 - 140
RDGFVCALLRFRQHLLGTSPERVVQHLCQRRVEPPELPADLQHWISYNEASSQLLRMESGLSDVTKDQ      141 - 208
//

Text Mined References (8)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.