Property Summary

NCBI Gene PubMed Count 4
PubMed Score 91.71
PubTator Score 8.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 8.3e-08
psoriasis 6694 1.7e-04
ovarian cancer 8520 2.0e-04
interstitial cystitis 2312 1.1e-03
Disease Target Count Z-score Confidence
Discharging ear 3 4.841 2.4
Enophthalmos 75 3.289 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial cystitis -1.300 1.1e-03
malignant mesothelioma 2.800 8.3e-08
ovarian cancer 1.300 2.0e-04
psoriasis 1.600 1.7e-04

Gene RIF (1)

AA Sequence

MLGLLVALLALGLAVFALLDVWYLVRLPCAVLRARLLQPRVRDLLAEQRFPGRVLPSDLDLLLHMNNARY      1 - 70
LREADFARVAHLTRCGVLGALRELRAHTVLAASCARHRRSLRLLEPFEVRTRLLGWDDRAFYLEARFVSL     71 - 140
RDGFVCALLRFRQHLLGTSPERVVQHLCQRRVEPPELPADLQHWISYNEASSQLLRMESGLSDVTKDQ      141 - 208
//

Text Mined References (8)

PMID Year Title