Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.61
PubTator Score 1.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.4e-06
osteosarcoma 7950 9.0e-05
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 1.2

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.212 9.0e-05
ovarian cancer 1.500 2.4e-06

Gene RIF (5)

AA Sequence

MWSPEREAEAPAGGDPAGLLPPEWEEDEERMSFLFSAFKRSREVNSTDWDSKMGFWAPLVLSHSRRQGVV      1 - 70
RLRLRDLQEAFQRKGSVPLGLATVLQDLLRRGELQRESDFMASVDSSWISWGVGVFLLKPLKWTLSNMLG     71 - 140
DNKVPAEEVLVAVELLKEKAEEVYRLYQNSPLSSHPVVALSELSTLCANSCPDERTFYLVLLQLQKEKRV    141 - 210
TVLEQNGEKIVKFARGPRAKVSPVNDVDVGVYQLMQSEQLLSRKVESLSQEAERCKEEARRACRAGKKQL    211 - 280
ALRSLKAKQRTEKRIEALHAKLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQ    281 - 350
IQELCDTQDEVSQTLAGGVTNGLDFDSEELEKELDILLQDTTKEPLDLPDNPRNRHFTNSVPNPRISDAE    351 - 420
LEAELEKLSLSEGGLVPSSKSPKRQLEPTLKPL                                         421 - 453
//

Text Mined References (25)

PMID Year Title