Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

AA Sequence

MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVG      1 - 70
KEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGR     71 - 140
NTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI                              141 - 184
//

Text Mined References (5)

PMID Year Title
23070364 2012 Mammalian proapoptotic factor ChaC1 and its homologues function as ?-glutamyl cyclotransferases acting specifically on glutathione.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.