Property Summary

NCBI Gene PubMed Count 9
Grant Count 59
R01 Count 29
Funding $14,780,979.88
PubMed Score 1028.10
PubTator Score 459.76

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WUX1 B3KT20 B5MDE6 B7WPJ9 Q6PIW9 Q8WYU2 Q96PQ4
Symbols SN2
JM24
SNAT5
pp7194

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
17333282 A 50kb deletion at Xp11.23 including the two genes, SLC38A5 and FTSJ1 was found in 3 brothers with moderate to severe mental retardation.

AA Sequence

MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFEGKTSFGMSVFNLSNAIMGSGILGLA      1 - 70
YAMAHTGVIFFLALLLCIALLSSYSIHLLLTCAGIAGIRAYEQLGQRAFGPAGKVVVATVICLHNVGAMS     71 - 140
SYLFIIKSELPLVIGTFLYMDPEGDWFLKGNLLIIIVSVLIILPLALMKHLGYLGYTSGLSLTCMLFFLV    141 - 210
SVIYKKFQLGCAIGHNETAMESEALVGLPSQGLNSSCEAQMFTVDSQMSYTVPIMAFAFVCHPEVLPIYT    211 - 280
ELCRPSKRRMQAVANVSIGAMFCMYGLTATFGYLTFYSSVKAEMLHMYSQKDPLILCVRLAVLLAVTLTV    281 - 350
PVVLFPIRRALQQLLFPGKAFSWPRHVAIALILLVLVNVLVICVPTIRDIFGVIGSTSAPSLIFILPSIF    351 - 420
YLRIVPSEVEPFLSWPKIQALCFGVLGVLFMAVSLGFMFANWATGQSRMSGH                      421 - 472
//

Text Mined References (13)

PMID Year Title
23506890 Evolutionary origin of amino acid transporter families SLC32, SLC36 and SLC38 and physiological, pathological and therapeutic aspects.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22382077 2012 Pathogenesis of hepatic encephalopathy and brain edema in acute liver failure: role of glutamine redefined.
18418736 2008 The evolutionary history and tissue mapping of amino acid transporters belonging to solute carrier families SLC32, SLC36, and SLC38.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
17333282 2007 Loss of SLC38A5 and FTSJ1 at Xp11.23 in three brothers with non-syndromic mental retardation due to a microdeletion in an unstable genomic region.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...