Property Summary

NCBI Gene PubMed Count 18
PubMed Score 28.06
PubTator Score 15.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 3.7e-03
primary pancreatic ductal adenocarcinoma 1109 4.1e-03
Disease Target Count Z-score Confidence
Nance-Horan syndrome 25 4.091 2.0
Hemangioma 69 3.232 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.100 3.7e-03
primary pancreatic ductal adenocarcinoma 1.016 4.1e-03

Gene RIF (7)

AA Sequence

MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK      1 - 70
GETLT                                                                      71 - 75
//

Text Mined References (23)

PMID Year Title