Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.02
PubTator Score 5.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.400 4.2e-05
astrocytic glioma 1.300 2.4e-02
atypical teratoid / rhabdoid tumor 1.100 2.8e-05
ependymoma 1.500 2.0e-02
glioblastoma 1.500 3.7e-03
oligodendroglioma 1.700 2.5e-03
osteosarcoma 2.851 1.8e-08
ovarian cancer -1.300 4.0e-06
Pick disease 1.200 4.7e-04
primitive neuroectodermal tumor 1.100 1.3e-03
psoriasis -1.300 1.3e-08

Gene RIF (3)

AA Sequence

MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGFGAATFASTSA      1 - 70
TPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAE     71 - 140
SIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEE    141 - 210
DLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKESVANHL               211 - 269
//

Text Mined References (17)

PMID Year Title