Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.39
PubTator Score 5.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 2.000 0.011
ependymoma 1.500 0.020
oligodendroglioma 1.700 0.002
psoriasis 1.900 0.000
glioblastoma 1.500 0.004
osteosarcoma 4.302 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
primitive neuroectodermal tumor 1.100 0.001
adult high grade glioma 1.400 0.000
Pick disease 1.200 0.000
ovarian cancer -1.500 0.000

Synonym

Accession Q8WUU5 B2RE37 D6W5Q5 Q8N5Y5 Q99995 Q9H689
Symbols ODAG
CMD2B
RG083M05.2

Gene

Gene RIF (3)

PMID Text
24462704 GATAD1 expression was significantly decreased in the third-trimester placentas associated with preeclampsia than those associated with normal pregnancy.
21965549 GATAD1 mutation is associated with autosomal recessive dilated cardiomyopathy.
20546612 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGFGAATFASTSA      1 - 70
TPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAE     71 - 140
SIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEE    141 - 210
DLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKESVANHL               211 - 269
//

Publication (16)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
24462704 2014 Decreased expression and DNA methylation levels of GATAD1 in preeclamptic placentas.
21965549 2011 Homozygosity mapping and exome sequencing reveal GATAD1 mutation in autosomal recessive dilated cardiomyopathy.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
18391951 2008 Many sequence variants affecting diversity of adult human height.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...