Property Summary

NCBI Gene PubMed Count 5
Grant Count 4
Funding $121,589
PubMed Score 3.13
PubTator Score 2.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.813 0.000
facioscapulohumeral dystrophy 3.800 0.000

Gene RIF (1)

PMID Text
19255975 novel translocation t(17;19)(q22;q13.32)in acute myeloid leukemia mapping to 352 bp 5 of MPO on 17q & 2,085 bp 5 of ZNF342 on 19q on derivative chromosome 17; higher level of ZNF342 expression in acute lymphoblastic leukemia associated with poorer outcome

AA Sequence

MSRRKAGSAPRRVEPAPAANPDDEMEMQDLVIELKPEPDAQPQQAPRLGPFSPKEVSSAGRFGGEPHHSP      1 - 70
GPMPAGAALLALGPRNPWTLWTPLTPNYPDRQPWTDKHPDLLTCGRCLQTFPLEAITAFMDHKKLGCQLF     71 - 140
RGPSRGQGSEREELKALSCLRCGKQFTVAWKLLRHAQWDHGLSIYQTESEAPEAPLLGLAEVAAAVSAVV    141 - 210
GPAAEAKSPRASGSGLTRRSPTCPVCKKTLSSFSNLKVHMRSHTGERPYACDQCPYACAQSSKLNRHKKT    211 - 280
HRQVPPQSPLMADTSQEQASAAPPEPAVHAAAPTSTLPCSGGEGAGAAATAGVQEPGAPGSGAQAGPGGD    281 - 350
TWGAITTEQRTDPANSQKASPKKMPKSGGKSRGPGGSCEFCGKHFTNSSNLTVHRRSHTGERPYTCEFCN    351 - 420
YACAQSSKLNRHRRMHGMTPGSTRFECPHCHVPFGLRATLDKHLRQKHPEAAGEA                   421 - 475
//

Text Mined References (5)

PMID Year Title
19255975 2009 Overexpression of ZNF342 by juxtaposition with MPO promoter/enhancer in the novel translocation t(17;19)(q23;q13.32) in pediatric acute myeloid leukemia and analysis of ZNF342 expression in leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14633674 2003 The contribution of genetic and epigenetic mechanisms to gene silencing in oligodendrogliomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11063263 2000 Cloning, structure, expression analysis, and assignment to mouse chromosome 7 of the gene Zfp296 encoding a zinc finger protein.