Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.34
PubTator Score 6.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.900 5.0e-04
Astrocytoma, Pilocytic 2.500 1.6e-07
atypical teratoid / rhabdoid tumor 1.300 1.4e-02
ependymoma 2.200 3.5e-09
glioblastoma 2.400 1.4e-08
intraductal papillary-mucinous neoplasm ... 1.400 3.2e-02
ovarian cancer -1.300 1.5e-02
tuberculosis 2.200 3.9e-07

Gene RIF (5)

AA Sequence

MATWRRDGRLTGGQRLLCAGLAGTLSLSLTAPLELATVLAQVGVVRGHARGPWATGHRVWRAEGLRALWK      1 - 70
GNAVACLRLFPCSAVQLAAYRKFVVLFTDDLGHISQWSSIMAGSLAGMVSTIVTYPTDLIKTRLIMQNIL     71 - 140
EPSYRGLLHAFSTIYQQEGFLALYRGVSLTVVGALPFSAGSLLVYMNLEKIWNGPRDQFSLPQNFANVCL    141 - 210
AAAVTQTLSFPFETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQIVKAQGVLGLWNGLTANLLKIVPYF    211 - 280
GIMFSTFEFCKRICLYQNGYILSPLSYKLTPGVDQSLQPQELRELKKFFKTRKPKPKKPTL             281 - 341
//

Text Mined References (12)

PMID Year Title