Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.44
PubTator Score 6.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (5)

PMID Text
26721434 In line with our previous results, we show a role for SLC25A43 as a regulator of cell cycle progression and proliferation through a putative mitochondrial checkpoint.
23354756 Our findings demonstrate that the mitochondrial protein SLC25A43 affects drug efficacy and cell cycle regulation following drug exposure in breast cancer cell lines.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
22883974 Our results indicate a possible role of SLC25A43 in HER2-positive breast cancer and support the hypothesis of altered mitochondrial function in cancer.
22430806 associations between site-specific methylation and clinicopathological parameters suggest that epigenetic changes in SLC25A43 gene could be of importance in breast carcinogenesis.

AA Sequence

MATWRRDGRLTGGQRLLCAGLAGTLSLSLTAPLELATVLAQVGVVRGHARGPWATGHRVWRAEGLRALWK      1 - 70
GNAVACLRLFPCSAVQLAAYRKFVVLFTDDLGHISQWSSIMAGSLAGMVSTIVTYPTDLIKTRLIMQNIL     71 - 140
EPSYRGLLHAFSTIYQQEGFLALYRGVSLTVVGALPFSAGSLLVYMNLEKIWNGPRDQFSLPQNFANVCL    141 - 210
AAAVTQTLSFPFETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQIVKAQGVLGLWNGLTANLLKIVPYF    211 - 280
GIMFSTFEFCKRICLYQNGYILSPLSYKLTPGVDQSLQPQELRELKKFFKTRKPKPKKPTL             281 - 341
//

Text Mined References (12)

PMID Year Title
26721434 2016 Mitochondrial regulation of cell cycle progression through SLC25A43.
23354756 2013 The mitochondrial transport protein SLC25A43 affects drug efficacy and drug-induced cell cycle arrest in breast cancer cell lines.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
22883974 2012 The mitochondrial transporter SLC25A43 is frequently deleted and may influence cell proliferation in HER2-positive breast tumors.
22430806 2012 DNA methylation pattern of the SLC25A43 gene in breast cancer.
21623375 2011 Genome-wide association identifies three new susceptibility loci for Paget's disease of bone.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16949250 2006 Fourteen novel human members of mitochondrial solute carrier family 25 (SLC25) widely expressed in the central nervous system.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...