Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.21
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.7e-21
lung carcinoma 2843 3.6e-18
lung adenocarcinoma 2716 1.9e-07
non-small cell lung cancer 2890 3.7e-07
psoriasis 6694 4.0e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Li-Fraumeni syndrome 13 3.347 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma -1.300 1.9e-07
lung carcinoma -2.200 3.6e-18
non-small cell lung cancer -1.569 3.7e-07
ovarian cancer -4.000 1.7e-21
psoriasis -1.100 4.0e-05

Gene RIF (1)

AA Sequence

MRQTLPLLLLTVLRPSWADPPQEKVPLFRVTQQGPWGSSGSNATDSPCEGLPAADATALTLANRNLERLP      1 - 70
GCLPRTLRSLDASHNLLRALSTSELGHLEQLQVLTLRHNRIAALRWGPGGPAGLHTLDLSYNQLAALPPC     71 - 140
TGPALSSLRALALAGNPLRALQPRAFACFPALQLLNLSCTALGRGAQGGIAEAAFAGEDGAPLVTLEVLD    141 - 210
LSGTFLERVESGWIRDLPKLTSLYLRKMPRLTTLEGDIFKMTPNLQQLDCQDSPALASVATHIFQDTPHL    211 - 280
QVLLFQNCNLSSFPPWTLDSSQVLSINLFGNPLTCSCDLSWLLTDAKRTVLSRAADTMCAPAAGSSGPFS    281 - 350
ASLSLSQLPGVCQSDQSTTLGASHPPCFNRSTYAQGTTVAPSAAPATRPAGDQQSVSKAPNVGSRTIAAW    351 - 420
PHSDAREGTAPSTTNSVAGHSNSSVFPRAASTTRTQHRGEHAPELVLEPDISAASTPLASKLLGPFPTSW    421 - 490
DRSISSPQPGQRTHATPQAPNPSLSEGEIPVLLLDDYSEEEEGRKEEVGTPHQDVPCDYHPCKHLQTPCA    491 - 560
ELQRRWRCRCPGLSGEDTIPDPPRLQGVTETTDTSALVHWCAPNSVVHGYQIRYSAEGWAGNQSVVGVIY    561 - 630
ATARQHPLYGLSPGTTYRVCVLAANRAGLSQPRSSGWRSPCAAFTTKPSFALLLSGLCAASGLLLASTVV    631 - 700
LSACLCRRGQTLGLQRCDTHLVAYKNPAFDDYPLGLQTVS                                  701 - 740
//

Text Mined References (11)

PMID Year Title