Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.21
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
non-small cell lung cancer -1.637 0.000
lung adenocarcinoma -1.400 0.000
lung carcinoma -2.200 0.000
ovarian cancer -4.200 0.000
psoriasis -1.100 0.000

Synonym

Accession Q8WUT4 A8K258 Q5JWV6 Q9H419
Symbols NLRR4
NLRR-4
C20orf75
dJ1056H1.1

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
21984916 LRRN4 was only detected in primary mesothelial cells, but MSLN and UPK3B were also detected in other cell types.

AA Sequence

MRQTLPLLLLTVLRPSWADPPQEKVPLFRVTQQGPWGSSGSNATDSPCEGLPAADATALTLANRNLERLP      1 - 70
GCLPRTLRSLDASHNLLRALSTSELGHLEQLQVLTLRHNRIAALRWGPGGPAGLHTLDLSYNQLAALPPC     71 - 140
TGPALSSLRALALAGNPLRALQPRAFACFPALQLLNLSCTALGRGAQGGIAEAAFAGEDGAPLVTLEVLD    141 - 210
LSGTFLERVESGWIRDLPKLTSLYLRKMPRLTTLEGDIFKMTPNLQQLDCQDSPALASVATHIFQDTPHL    211 - 280
QVLLFQNCNLSSFPPWTLDSSQVLSINLFGNPLTCSCDLSWLLTDAKRTVLSRAADTMCAPAAGSSGPFS    281 - 350
ASLSLSQLPGVCQSDQSTTLGASHPPCFNRSTYAQGTTVAPSAAPATRPAGDQQSVSKAPNVGSRTIAAW    351 - 420
PHSDAREGTAPSTTNSVAGHSNSSVFPRAASTTRTQHRGEHAPELVLEPDISAASTPLASKLLGPFPTSW    421 - 490
DRSISSPQPGQRTHATPQAPNPSLSEGEIPVLLLDDYSEEEEGRKEEVGTPHQDVPCDYHPCKHLQTPCA    491 - 560
ELQRRWRCRCPGLSGEDTIPDPPRLQGVTETTDTSALVHWCAPNSVVHGYQIRYSAEGWAGNQSVVGVIY    561 - 630
ATARQHPLYGLSPGTTYRVCVLAANRAGLSQPRSSGWRSPCAAFTTKPSFALLLSGLCAASGLLLASTVV    631 - 700
LSACLCRRGQTLGLQRCDTHLVAYKNPAFDDYPLGLQTVS                                  701 - 740
//

Text Mined References (11)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21984916 2011 LRRN4 and UPK3B are markers of primary mesothelial cells.
19448619 2009 Loci at chromosomes 13, 19 and 20 influence age at natural menopause.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15870286 2005 Neuronal leucine-rich repeat protein 4 functions in hippocampus-dependent long-lasting memory.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...