Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis -1.195 0.034
interstitial cystitis -1.400 0.001
psoriasis 1.300 0.000
Breast cancer -1.600 0.000
mucosa-associated lymphoid tissue lympho... -1.007 0.019
acute myeloid leukemia -1.300 0.044

Gene RIF (1)

PMID Text
22082156 Knockdown of short chain dehydrogenase/reductase family 42E, member 1 (SDR42E1) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MDPKRSQKESVLITGGSGYFGFRLGCALNQNGVHVILFDISSPAQTIPEGIKFIQGDIRHLSDVEKAFQD      1 - 70
ADVTCVFHIASYGMSGREQLNRNLIKEVNVRGTDNILQVCQRRRVPRLVYTSTFNVIFGGQVIRNGDESL     71 - 140
PYLPLHLHPDHYSRTKSIAEQKVLEANATPLDRGDGVLRTCALRPAGIYGPGEQRHLPRIVSYIEKGLFK    141 - 210
FVYGDPRSLVEFVHVDNLVQAHILASEALRADKGHIASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPST    211 - 280
RLPLTLVYCFAFLTEMVHFILGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWF    281 - 350
KAHGHGRSSGSRDSECFVWDGLLVFLLIIAVLMWLPSSVILSL                               351 - 393
//

Text Mined References (7)

PMID Year Title
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.