Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis -1.195 3.4e-02
acute myeloid leukemia -1.300 4.4e-02
Breast cancer -1.600 5.8e-10
interstitial cystitis -1.100 2.7e-02
mucosa-associated lymphoid tissue lympho... -1.007 1.9e-02
psoriasis 1.200 2.2e-06

Gene RIF (1)

AA Sequence

MDPKRSQKESVLITGGSGYFGFRLGCALNQNGVHVILFDISSPAQTIPEGIKFIQGDIRHLSDVEKAFQD      1 - 70
ADVTCVFHIASYGMSGREQLNRNLIKEVNVRGTDNILQVCQRRRVPRLVYTSTFNVIFGGQVIRNGDESL     71 - 140
PYLPLHLHPDHYSRTKSIAEQKVLEANATPLDRGDGVLRTCALRPAGIYGPGEQRHLPRIVSYIEKGLFK    141 - 210
FVYGDPRSLVEFVHVDNLVQAHILASEALRADKGHIASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPST    211 - 280
RLPLTLVYCFAFLTEMVHFILGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWF    281 - 350
KAHGHGRSSGSRDSECFVWDGLLVFLLIIAVLMWLPSSVILSL                               351 - 393
//

Text Mined References (7)

PMID Year Title