Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 5.8043026443124E-10
psoriasis 6685 2.19666325676586E-9
interstitial cystitis 2299 9.51912806092054E-4
mucosa-associated lymphoid tissue lymphoma 480 0.0188392324442833
active ulcerative colitis 477 0.0338348087934299
acute myeloid leukemia 785 0.0444880126144176

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis -1.195 0.034
interstitial cystitis -1.400 0.001
psoriasis 1.300 0.000
Breast cancer -1.600 0.000
mucosa-associated lymphoid tissue lympho... -1.007 0.019
acute myeloid leukemia -1.300 0.044

Synonym

Accession Q8WUS8 B2RDS1 Q9P0D1
Symbols HSPC105

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (1)

PMID Text
22082156 Knockdown of short chain dehydrogenase/reductase family 42E, member 1 (SDR42E1) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MDPKRSQKESVLITGGSGYFGFRLGCALNQNGVHVILFDISSPAQTIPEGIKFIQGDIRHLSDVEKAFQD      1 - 70
ADVTCVFHIASYGMSGREQLNRNLIKEVNVRGTDNILQVCQRRRVPRLVYTSTFNVIFGGQVIRNGDESL     71 - 140
PYLPLHLHPDHYSRTKSIAEQKVLEANATPLDRGDGVLRTCALRPAGIYGPGEQRHLPRIVSYIEKGLFK    141 - 210
FVYGDPRSLVEFVHVDNLVQAHILASEALRADKGHIASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPST    211 - 280
RLPLTLVYCFAFLTEMVHFILGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWF    281 - 350
KAHGHGRSSGSRDSECFVWDGLLVFLLIIAVLMWLPSSVILSL                               351 - 393
//

Text Mined References (7)

PMID Year Title
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.