Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
aldosterone-producing adenoma -1.114 2.8e-02
ovarian cancer 1.400 5.8e-03
progressive supranuclear palsy -1.100 3.4e-02

AA Sequence

MLRLRSGLRHLRATPNTRGSARLLCAEMPKKAGATTKGKSQSKEPERPLPPLGPVAVDPKGCVTIAIHAK      1 - 70
PGSKQNAVTDLTAEAVNVAIAAPPSEGEANAELCRYLSKVLELRKSDVVLDKGGKSREKVVKLLASTTPE     71 - 140
EILEKLKKEAKKT                                                             141 - 153
//

Text Mined References (13)

PMID Year Title