Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
aldosterone-producing adenoma -1.114 0.028
progressive supranuclear palsy -1.100 0.034
ovarian cancer 1.400 0.006

AA Sequence

MLRLRSGLRHLRATPNTRGSARLLCAEMPKKAGATTKGKSQSKEPERPLPPLGPVAVDPKGCVTIAIHAK      1 - 70
PGSKQNAVTDLTAEAVNVAIAAPPSEGEANAELCRYLSKVLELRKSDVVLDKGGKSREKVVKLLASTTPE     71 - 140
EILEKLKKEAKKT                                                             141 - 153
//

Text Mined References (13)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...