Property Summary

NCBI Gene PubMed Count 20
PubMed Score 18.68
PubTator Score 4.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.400 0.006
osteosarcoma 1.145 0.001
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.100 0.000
adult high grade glioma -1.500 0.000

Synonym

Accession Q8WUQ7 A6NNA9 A9UL12 O75229 Q7LE08 Q9BTA6 Q9Y5A4
Symbols fSAPc
C19orf29
NY-REN-24

Gene

 GO Function (1)

Gene RIF (4)

PMID Text
26363554 TRIM39 negatively regulates the NFkappaB signaling pathway possibly via stabilization of cactin.
26033110 results indicate that PKC-mediated cortactin phosphorylation might be implicated in the maintenance of growth cone
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGRDTRSRSRSAGRRGRRRQSQSGSRSRSRSHGRRNRRRREDEGRRRRRRRSRERRSDSEEERWQRSGMR      1 - 70
SRSPPRPKWHSRDGSSQSDSGEEQSRGQWARRRRRARSWSPSSSASSSASPGRSQSPRAAAAALSQQQSL     71 - 140
QERLRLREERKQQEELMKAFETPEEKRARRLAKKEAKERKKREKMGWGEEYMGYTNTDNPFGDNNLLGTF    141 - 210
IWNKALEKKGISHLEEKELKERNKRIQEDNRLELQKVKQLRLEREREKAMREQELEMLQREKEAEHFKTW    211 - 280
EEQEDNFHLQQAKLRSKIRIRDGRAKPIDLLAKYISAEDDDLAVEMHEPYTFLNGLTVADMEDLLEDIQV    281 - 350
YMELEQGKNADFWRDMTTITEDEISKLRKLEASGKGPGERREGVNASVSSDVQSVFKGKTYNQLQVIFQG    351 - 420
IEGKIRAGGPNLDMGYWESLLQQLRAHMARARLRERHQDVLRQKLYKLKQEQGVESEPLFPILKQEPQSP    421 - 490
SRSLEPEDAAPTPPGPSSEGGPAEAEVDGATPTEGDGDGDGEGEGEGEAVLMEEDLIQQSLDDYDAGRYS    491 - 560
PRLLTAHELPLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTGK    561 - 630
AYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACA    631 - 700
DNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR                701 - 758
//

Text Mined References (22)

PMID Year Title
26363554 2016 TRIM39 negatively regulates the NF?B-mediated signaling pathway through stabilization of Cactin.
26033110 2015 Possible role of cortactin phosphorylation by protein kinase C? in actin-bundle formation at growth cone.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21429463 2011 Evolution and comparative genomics of subcellular specializations: EST sequencing of Torpedo electric organ.
20829348 2010 Cactin targets the MHC class III protein IkappaB-like (IkappaBL) and inhibits NF-kappaB and interferon-regulatory factor signaling pathways.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...