Property Summary

NCBI Gene PubMed Count 20
PubMed Score 18.68
PubTator Score 4.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma 5572 1.51451769058609E-5
medulloblastoma, large-cell 6234 1.81918258138031E-5
adult high grade glioma 2148 5.56489981949878E-5
osteosarcoma 7933 9.03640258267327E-4
ependymoma 2514 0.0056029907998434
Disease Target Count Z-score Confidence
Dilated cardiomyopathy 51 3.373 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.400 0.006
osteosarcoma 1.145 0.001
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.100 0.000
adult high grade glioma -1.500 0.000

Synonym

Accession Q8WUQ7 A6NNA9 A9UL12 O75229 Q7LE08 Q9BTA6 Q9Y5A4
Symbols fSAPc
C19orf29
NY-REN-24

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid

 GO Function (1)

Pathway (1)

Gene RIF (4)

PMID Text
26363554 TRIM39 negatively regulates the NFkappaB signaling pathway possibly via stabilization of cactin.
26033110 results indicate that PKC-mediated cortactin phosphorylation might be implicated in the maintenance of growth cone
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGRDTRSRSRSAGRRGRRRQSQSGSRSRSRSHGRRNRRRREDEGRRRRRRRSRERRSDSEEERWQRSGMR      1 - 70
SRSPPRPKWHSRDGSSQSDSGEEQSRGQWARRRRRARSWSPSSSASSSASPGRSQSPRAAAAALSQQQSL     71 - 140
QERLRLREERKQQEELMKAFETPEEKRARRLAKKEAKERKKREKMGWGEEYMGYTNTDNPFGDNNLLGTF    141 - 210
IWNKALEKKGISHLEEKELKERNKRIQEDNRLELQKVKQLRLEREREKAMREQELEMLQREKEAEHFKTW    211 - 280
EEQEDNFHLQQAKLRSKIRIRDGRAKPIDLLAKYISAEDDDLAVEMHEPYTFLNGLTVADMEDLLEDIQV    281 - 350
YMELEQGKNADFWRDMTTITEDEISKLRKLEASGKGPGERREGVNASVSSDVQSVFKGKTYNQLQVIFQG    351 - 420
IEGKIRAGGPNLDMGYWESLLQQLRAHMARARLRERHQDVLRQKLYKLKQEQGVESEPLFPILKQEPQSP    421 - 490
SRSLEPEDAAPTPPGPSSEGGPAEAEVDGATPTEGDGDGDGEGEGEGEAVLMEEDLIQQSLDDYDAGRYS    491 - 560
PRLLTAHELPLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTGK    561 - 630
AYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACA    631 - 700
DNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR                701 - 758
//

Text Mined References (22)

PMID Year Title
26363554 2016 TRIM39 negatively regulates the NF?B-mediated signaling pathway through stabilization of Cactin.
26033110 2015 Possible role of cortactin phosphorylation by protein kinase C? in actin-bundle formation at growth cone.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21429463 2011 Evolution and comparative genomics of subcellular specializations: EST sequencing of Torpedo electric organ.
20829348 2010 Cactin targets the MHC class III protein IkappaB-like (IkappaBL) and inhibits NF-kappaB and interferon-regulatory factor signaling pathways.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...