Property Summary

NCBI Gene PubMed Count 29
Grant Count 21
R01 Count 20
Funding $1,832,451.85
PubMed Score 22.36
PubTator Score 93.87

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
23645746 Migfilin expression is reduced in breast cancer.
23237804 the present study emphasizes for the first time to our knowledge the role of Migfilin in osteoarthritis(OA) and highlights the importance of cell-ECM adhesion proteins in OA pathogenesis.
23099104 alpha-parvin, beta-parvin and migfilin were expressed in tumor cells in 53%, 2%, 28% and 53% of effusions and 57%, 20%, 83% and 25% of solid lesions, respectively.
22843679 Migfilin positively modulates the expression and activity of epidermal growth factor receptor, and Migfilin-mediated migration and invasion depend on epidermal growth factor receptor-induced PLC-gamma and STAT3-signaling pathways.
22246236 Migfilin promoted beta-catenin degradation by reinforcing the association between beta-catenin and GSK-3beta.
22043318 Migfilin can activate beta1, beta2 and beta3 integrins and promote integrin mediated responses while migfilin depletion impairs the spreading and migration of endothelial cells
19833732 Migfilin interacts with Src and contributes to cell-matrix adhesion-mediated survival signaling
19074766 Migfilin thus acts as a molecular switch to disconnect filamin from integrin for regulating integrin activation and dynamics of extracellular matrix-actin linkage.
18854154 Knockdown of filamin binding LIM protein 1 (FBLIM1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18829455 analysis of the migfilin-filamin interaction and competition with integrin beta 7 tails
More...

AA Sequence

MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRPSPWTTPGRAA      1 - 70
ATVPAAPMQLFNGGCPPPPPVLDGEDVLPDLDLLPPPPPPPPVLLPSEEEAPAPMGASLIADLEQLHLSP     71 - 140
PPPPPQAPAEGPSVQPGPLRPMEEELPPPPAEPVEKGASTDICAFCHKTVSPRELAVEAMKRQYHAQCFT    141 - 210
CRTCRRQLAGQSFYQKDGRPLCEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDES    211 - 280
FALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQG    281 - 350
CYPLNNHLFCKPCHVKRSAAGCC                                                   351 - 373
//

Text Mined References (30)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23645746 2013 Mitogen-inducible Gene-2 (MIG2) and migfilin expression is reduced in samples of human breast cancer.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
23237804 2013 Migfilin's elimination from osteoarthritic chondrocytes further promotes the osteoarthritic phenotype via ?-catenin upregulation.
23099104 2013 Migfilin, ?-parvin and ?-parvin are differentially expressed in ovarian serous carcinoma effusions, primary tumors and solid metastases.
22843679 2012 Migfilin protein promotes migration and invasion in human glioma through epidermal growth factor receptor-mediated phospholipase C-? and STAT3 protein signaling pathways.
22246236 2012 Migfilin regulates esophageal cancer cell motility through promoting GSK-3?-mediated degradation of ?-catenin.
22043318 2011 Migfilin and filamin as regulators of integrin activation in endothelial cells and neutrophils.
21524097 2011 Evidence for multisite ligand binding and stretching of filamin by integrin and migfilin.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
More...