Property Summary

NCBI Gene PubMed Count 31
PubMed Score 25.88
PubTator Score 93.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease -1.095 2.0e-02
adrenocortical carcinoma -1.082 4.7e-03
adult high grade glioma 1.600 5.9e-06
Astrocytoma, Pilocytic 1.100 5.1e-04
atypical teratoid / rhabdoid tumor 1.400 2.2e-05
gastric carcinoma 1.400 1.4e-02
glioblastoma 1.300 1.9e-06
group 4 medulloblastoma 1.600 2.5e-06
interstitial lung disease 1.300 8.5e-03
medulloblastoma, large-cell 1.200 3.6e-04
osteosarcoma 1.688 1.5e-03
pancreatic cancer 1.500 7.8e-04
pancreatic ductal adenocarcinoma liver m... 1.851 2.2e-02
primitive neuroectodermal tumor 1.100 1.6e-03

 IMPC Phenotype (2)

Gene RIF (16)

AA Sequence

MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRPSPWTTPGRAA      1 - 70
ATVPAAPMQLFNGGCPPPPPVLDGEDVLPDLDLLPPPPPPPPVLLPSEEEAPAPMGASLIADLEQLHLSP     71 - 140
PPPPPQAPAEGPSVQPGPLRPMEEELPPPPAEPVEKGASTDICAFCHKTVSPRELAVEAMKRQYHAQCFT    141 - 210
CRTCRRQLAGQSFYQKDGRPLCEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDES    211 - 280
FALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQG    281 - 350
CYPLNNHLFCKPCHVKRSAAGCC                                                   351 - 373
//

Text Mined References (32)

PMID Year Title