Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.96
PubTator Score 5.54

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
25207809 A ubiquitin shuttle DC-UbP reconciles protein ubiquitination and deubiquitination via linking UbE1 and USP5 enzymes.
20440844 The results show that DC-UbP_N holds a novel structural fold and acts as a Ub-binding domain (UBD) but with low affinity.
15987890 Solution NMR structure of the ubiquitin-like domain of DC-UbP is very similar to that of ubiquitin despite low similarity (<30%) in amino-acid sequence.
12507522 cloning and identification; DC-UbP might be downregulated during cellular differentiation and apoptosis

AA Sequence

MGGCVGAQHDSSGSLNENSEGTGVALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEI      1 - 70
WDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLD     71 - 140
IPEPPPNSGYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEEL    141 - 210
KIPKDYVVQVIVSQPVQNPTPVEN                                                  211 - 234
//

Text Mined References (10)

PMID Year Title
25207809 2014 A ubiquitin shuttle DC-UbP/UBTD2 reconciles protein ubiquitination and deubiquitination via linking UbE1 and USP5 enzymes.
20440844 2010 Solution structure of the N-terminal domain of DC-UbP/UBTD2 and its interaction with ubiquitin.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15987890 2005 Solution structure of the ubiquitin-like domain of human DC-UbP from dendritic cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12507522 2003 Cloning and identification of a novel human ubiquitin-like protein, DC-UbP, from dendritic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.