Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.96
PubTator Score 5.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 3.14331344704101E-13
oligodendroglioma 2849 5.36644793340059E-12
Duchenne muscular dystrophy 602 9.22819123990399E-8
osteosarcoma 7933 1.2235557327087E-5
atypical teratoid / rhabdoid tumor 4369 2.56904714346877E-5
hepatocellular carcinoma 550 2.78385362783465E-5
tuberculosis and treatment for 6 months 686 2.26261001097748E-4
group 4 medulloblastoma 1875 6.53546191695697E-4
pancreatic carcinoma 567 0.00292591907219538
pancreatic cancer 2300 0.00292591907219543
primitive neuroectodermal tumor 3031 0.00392793016225639
gastric cancer 436 0.00470228042095092
medulloblastoma, large-cell 6234 0.00632298246802219
Breast cancer 3099 0.0307765710540876
subependymal giant cell astrocytoma 2287 0.0412273638608194
Disease Target Count Z-score Confidence
Vesicoureteral reflux 28 3.475 1.7
Holoprosencephaly 52 3.136 1.6

Expression

Synonym

Accession Q8WUN7 Q8TDQ3
Symbols DCUBP

Gene

PANTHER Protein Class (2)

PDB

1TTN   2KSN  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (4)

PMID Text
25207809 A ubiquitin shuttle DC-UbP reconciles protein ubiquitination and deubiquitination via linking UbE1 and USP5 enzymes.
20440844 The results show that DC-UbP_N holds a novel structural fold and acts as a Ub-binding domain (UBD) but with low affinity.
15987890 Solution NMR structure of the ubiquitin-like domain of DC-UbP is very similar to that of ubiquitin despite low similarity (<30%) in amino-acid sequence.
12507522 cloning and identification; DC-UbP might be downregulated during cellular differentiation and apoptosis

AA Sequence

MGGCVGAQHDSSGSLNENSEGTGVALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEI      1 - 70
WDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLD     71 - 140
IPEPPPNSGYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEEL    141 - 210
KIPKDYVVQVIVSQPVQNPTPVEN                                                  211 - 234
//

Text Mined References (10)

PMID Year Title
25207809 2014 A ubiquitin shuttle DC-UbP/UBTD2 reconciles protein ubiquitination and deubiquitination via linking UbE1 and USP5 enzymes.
20440844 2010 Solution structure of the N-terminal domain of DC-UbP/UBTD2 and its interaction with ubiquitin.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15987890 2005 Solution structure of the ubiquitin-like domain of human DC-UbP from dendritic cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12507522 2003 Cloning and identification of a novel human ubiquitin-like protein, DC-UbP, from dendritic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.