Property Summary

NCBI Gene PubMed Count 34
PubMed Score 59.58
PubTator Score 41.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease -2.223 6.2e-03
active ulcerative colitis -1.794 2.1e-02
acute quadriplegic myopathy 1.510 6.8e-09
astrocytic glioma -1.100 3.4e-02
atypical teratoid / rhabdoid tumor 1.100 1.2e-02
Barrett's esophagus 1.600 1.5e-02
breast carcinoma 1.100 1.6e-05
cutaneous lupus erythematosus 1.100 1.6e-03
dermatomyositis 1.600 2.1e-03
ductal carcinoma in situ 1.500 8.5e-05
esophageal adenocarcinoma 1.800 1.8e-02
fibroadenoma 1.100 1.4e-03
gastric carcinoma 1.500 3.0e-02
glioblastoma 1.800 3.5e-02
intraductal papillary-mucinous neoplasm ... 1.500 1.1e-02
invasive ductal carcinoma 1.600 7.8e-05
juvenile dermatomyositis 1.185 2.6e-10
Multiple myeloma 1.437 1.2e-02
non primary Sjogren syndrome sicca -1.200 1.3e-02
non-small cell lung cancer -1.091 4.3e-06
ovarian cancer -1.500 4.9e-06
pancreatic cancer 2.200 7.1e-03
pancreatic ductal adenocarcinoma liver m... 3.027 3.1e-03
Pick disease -1.100 2.4e-03
pituitary cancer -1.700 1.5e-03
primitive neuroectodermal tumor 1.700 2.3e-04
psoriasis -1.300 4.5e-05
Rheumatoid arthritis 1.800 4.4e-02

Gene RIF (20)

AA Sequence

MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFE      1 - 70
TVGSVLLGAKVSETIRKGLIDVEMYNSTQGLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGF     71 - 140
SLVAKGQEGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILHKADPVPNGLRALPVFYACTVGINL    141 - 210
FSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREIKCSPSESPLMEKKNSLKE    211 - 280
DHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNG    281 - 350
AVQLPNGNLVQFSQAVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAKVGDCMGDSGDKPLRRNNSYTS    351 - 420
YTMAICGMPLDSFRAKEGEQKGEEMEKLTWPNADSKKRIRMDSYTSYCNAVSDLHSASEIDMSVKAEMGL    421 - 490
GDRKGSNGSLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYDTGDVSSKVAT    491 - 560
PIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTHCKVGSV    561 - 630
VSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAIFRYVILRM                         631 - 679
//

Text Mined References (37)

PMID Year Title