Property Summary

NCBI Gene PubMed Count 33
Grant Count 183
R01 Count 128
Funding $15,547,099.49
PubMed Score 51.24
PubTator Score 41.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WUM9 Q08344 Q6DHX8 Q9UQ82
Symbols PIT1
GLVR1
PiT-1
Glvr-1

Gene

Gene RIF (18)

PMID Text
23849774 Ox-LDL induces an osteogenic change in human aortic valve interstitial cells marked by the induction of PiT-1.
23308213 Overexpression of SLC20A1 promotes apoptosis and mineralization by altering the level of Akt-1.
21796222 Allelic variations in SLC20A1 were associated with the levels of Sodium-lithium countertransport.
21586110 the human PiT2 histidine, H(502), and the human PiT1 glutamate, E(70),--both conserved in eukaryotic PiT family members--are critical for P(i) transport function
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20817733 Identification of a novel transport-independent function of PiT1/SLC20A1 in the regulation of TNF-induced apoptosis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19726692 PiT1 depletion markedly reduces cell proliferation, delays cell cycle, and impairs mitosis and cytokinesis.
18729813 An overexpression of Pit-1 seems to play a key role in the formation of soft tissue calcification in Werner syndrome.
More...

AA Sequence

MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFE      1 - 70
TVGSVLLGAKVSETIRKGLIDVEMYNSTQGLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGF     71 - 140
SLVAKGQEGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILHKADPVPNGLRALPVFYACTVGINL    141 - 210
FSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREIKCSPSESPLMEKKNSLKE    211 - 280
DHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNG    281 - 350
AVQLPNGNLVQFSQAVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAKVGDCMGDSGDKPLRRNNSYTS    351 - 420
YTMAICGMPLDSFRAKEGEQKGEEMEKLTWPNADSKKRIRMDSYTSYCNAVSDLHSASEIDMSVKAEMGL    421 - 490
GDRKGSNGSLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYDTGDVSSKVAT    491 - 560
PIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTHCKVGSV    561 - 630
VSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAIFRYVILRM                         631 - 679
//

Text Mined References (36)

PMID Year Title
23849774 2013 ox-LDL induces PiT-1 expression in human aortic valve interstitial cells.
23308213 2013 High expression of the Pi-transporter SLC20A1/Pit1 in calcific aortic valve disease promotes mineralization through regulation of Akt-1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21796222 2011 Association between SLC20A1 and sodium-lithium countertransport.
21586110 2011 Mapping of the minimal inorganic phosphate transporting unit of human PiT2 suggests a structure universal to PiT-related proteins from all kingdoms of life.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20817733 2010 Identification of a novel transport-independent function of PiT1/SLC20A1 in the regulation of TNF-induced apoptosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19726692 2009 Identification of a novel function of PiT1 critical for cell proliferation and independent of its phosphate transport activity.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...