Property Summary

NCBI Gene PubMed Count 33
PubMed Score 51.24
PubTator Score 41.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
juvenile dermatomyositis 1189 3.53592169825198E-9
acute quadriplegic myopathy 1157 4.34977273765273E-7
ovarian cancer 8492 6.11205548574936E-7
non-small cell lung cancer 2798 4.32584397840667E-6
breast carcinoma 1614 1.55151288487004E-5
psoriasis 6685 4.52911179535853E-5
invasive ductal carcinoma 2950 7.81278380831345E-5
ductal carcinoma in situ 1745 8.54398360255651E-5
primitive neuroectodermal tumor 3031 2.27619011309944E-4
primary pancreatic ductal adenocarcinoma 1271 5.07270641112696E-4
fibroadenoma 557 0.00135208053658496
pituitary cancer 1972 0.00145629724733545
cutaneous lupus erythematosus 1056 0.00159564228547589
pancreatic cancer 2300 0.00189504501684598
dermatomyositis 967 0.00205276432398302
Pick disease 1893 0.00235782155875967
primary Sjogren syndrome 789 0.00364169736849318
gastric carcinoma 832 0.006282533021637
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0113271625277109
Multiple myeloma 1328 0.0117194310765932
atypical teratoid / rhabdoid tumor 4369 0.0120741290064042
Barrett's esophagus 185 0.0150117323195808
esophageal adenocarcinoma 737 0.0176010007179145
active ulcerative colitis 477 0.0213993202928626
astrocytic glioma 2241 0.0341765742753621
glioblastoma 5572 0.0351100758999151
active Crohn's disease 918 0.0390043573487663
Rheumatoid Arthritis 1171 0.0435279117591966
Disease Target Count Z-score Confidence
Basal ganglia calcification 17 4.719 2.4
Hyperphosphatemia 32 3.729 1.9

Expression

Synonym

Accession Q8WUM9 Q08344 Q6DHX8 Q9UQ82
Symbols PIT1
GLVR1
PiT-1
Glvr-1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (18)

PMID Text
23849774 Ox-LDL induces an osteogenic change in human aortic valve interstitial cells marked by the induction of PiT-1.
23308213 Overexpression of SLC20A1 promotes apoptosis and mineralization by altering the level of Akt-1.
21796222 Allelic variations in SLC20A1 were associated with the levels of Sodium-lithium countertransport.
21586110 the human PiT2 histidine, H(502), and the human PiT1 glutamate, E(70),--both conserved in eukaryotic PiT family members--are critical for P(i) transport function
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20817733 Identification of a novel transport-independent function of PiT1/SLC20A1 in the regulation of TNF-induced apoptosis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19726692 PiT1 depletion markedly reduces cell proliferation, delays cell cycle, and impairs mitosis and cytokinesis.
18729813 An overexpression of Pit-1 seems to play a key role in the formation of soft tissue calcification in Werner syndrome.
More...

AA Sequence

MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFE      1 - 70
TVGSVLLGAKVSETIRKGLIDVEMYNSTQGLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGF     71 - 140
SLVAKGQEGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILHKADPVPNGLRALPVFYACTVGINL    141 - 210
FSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREIKCSPSESPLMEKKNSLKE    211 - 280
DHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNG    281 - 350
AVQLPNGNLVQFSQAVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAKVGDCMGDSGDKPLRRNNSYTS    351 - 420
YTMAICGMPLDSFRAKEGEQKGEEMEKLTWPNADSKKRIRMDSYTSYCNAVSDLHSASEIDMSVKAEMGL    421 - 490
GDRKGSNGSLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYDTGDVSSKVAT    491 - 560
PIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTHCKVGSV    561 - 630
VSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAIFRYVILRM                         631 - 679
//

Text Mined References (36)

PMID Year Title
23849774 2013 ox-LDL induces PiT-1 expression in human aortic valve interstitial cells.
23308213 2013 High expression of the Pi-transporter SLC20A1/Pit1 in calcific aortic valve disease promotes mineralization through regulation of Akt-1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21796222 2011 Association between SLC20A1 and sodium-lithium countertransport.
21586110 2011 Mapping of the minimal inorganic phosphate transporting unit of human PiT2 suggests a structure universal to PiT-related proteins from all kingdoms of life.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20817733 2010 Identification of a novel transport-independent function of PiT1/SLC20A1 in the regulation of TNF-induced apoptosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19726692 2009 Identification of a novel function of PiT1 critical for cell proliferation and independent of its phosphate transport activity.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...