Property Summary

NCBI Gene PubMed Count 140
Grant Count 4
Funding $776,660
PubMed Score 30.40
PubTator Score 154.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.088 0.005
astrocytoma 1.800 0.002
ependymoma 1.300 0.009
oligodendroglioma 1.200 0.015
glioblastoma 1.900 0.002
acute quadriplegic myopathy 1.267 0.000
non-small cell lung cancer -1.140 0.000
intraductal papillary-mucinous neoplasm ... 1.700 0.003
subependymal giant cell astrocytoma 1.188 0.017
Pick disease -1.500 0.000
ulcerative colitis -1.200 0.000
ovarian cancer 2.400 0.000

Synonym

Accession Q8WUM4 C5MQH7 E9PFU1 Q6NUS1 Q9BX86 Q9NUN0 Q9P2H2 Q9UKL5 PDCD6-interacting protein
Symbols AIP1
ALIX
HP95
DRIP4

Gene

PDB

2OEV   2OEW   2OEX   2OJQ   2R02   2R03   2R05   2XS1   2XS8   2ZNE   3C3O   3C3Q   3C3R   3E1R   3WUV   4JJY  

Gene RIF (205)

PMID Text
26929449 Accordingly, ALIX depletion leads to furrow regression in cells with chromosome bridges, a phenotype associated with abscission checkpoint signaling failure.
26866605 homologous domain of human Bro1 domain-containing proteins, Alix and Brox, binds CHMP4B but not STAM2, despite their high structural similarity
26859355 phosphorylation of the intramolecular interaction site in the PRD is one of the major mechanisms that activates the ESCRT function of ALIX
26490116 We found that ARRDC3 is required for ALIX ubiquitination induced by activation of PAR1
26139244 Our data reveal that AIP1, by inhibiting VEGFR2-dependent signaling in tumor niche, suppresses tumor EMT switch, tumor angiogenesis, and tumor premetastatic niche formation to limit tumor growth and metastasis.
26063962 Findings indicate that the PDCD6IP 15bp insertion/deletion polymorphism decreases the risk of breast neoplasm in an Iranian population.
25749978 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25732677 our findings identify heparanase as a modulator of the syndecan-syntenin-ALIX pathway, fostering endosomal membrane budding and the biogenesis of exosomes by trimming the heparan sulfate chains on syndecans
25710462 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25633977 Knockdown of programmed cell death 6 interacting protein (AIP1, ALIX) by siRNA inhibits HIV-1 release and infectivity
More...

AA Sequence

MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLR      1 - 70
YYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNL     71 - 140
DNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKD    141 - 210
AIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHA    211 - 280
AELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQK    281 - 350
FTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTK    351 - 420
SRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRA    421 - 490
EGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLD    491 - 560
EVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQ    561 - 630
VSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKT    631 - 700
ERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPS    701 - 770
ATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQS    771 - 840
PGQAPYPGPQQPSYPFPQPPQQSYYPQQ                                              841 - 868
//

Text Mined References (155)

PMID Year Title
26929449 2016 ALIX and ESCRT-I/II function as parallel ESCRT-III recruiters in cytokinetic abscission.
26866605 2016 Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0.
26859355 2016 Phosphorylation-Dependent Activation of the ESCRT Function of ALIX in Cytokinetic Abscission and Retroviral Budding.
26490116 2015 The ?-arrestin ARRDC3 mediates ALIX ubiquitination and G protein-coupled receptor lysosomal sorting.
26139244 2015 AIP1 Expression in Tumor Niche Suppresses Tumor Progression and Metastasis.
26063962 2015 Association between Programmed Cell Death 6 Interacting Protein Insertion/Deletion Polymorphism and the Risk of Breast Cancer in a Sample of Iranian Population.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25732677 2015 Heparanase activates the syndecan-syntenin-ALIX exosome pathway.
25534348 2014 Mechanism of Ca²?-triggered ESCRT assembly and regulation of cell membrane repair.
25510652 2015 Unravelling the pivotal role of Alix in MVB sorting and silencing of the activated EGFR.
More...