Property Summary

NCBI Gene PubMed Count 152
PubMed Score 35.13
PubTator Score 154.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.267 1.1e-08
astrocytic glioma 1.200 1.1e-02
ependymoma 1.300 9.2e-03
glioblastoma 1.900 1.6e-03
intraductal papillary-mucinous neoplasm ... 1.700 3.1e-03
non-small cell lung cancer -1.140 7.0e-17
oligodendroglioma 1.200 1.5e-02
ovarian cancer -1.300 7.5e-05
Pick disease -1.500 2.7e-05
subependymal giant cell astrocytoma 1.188 1.7e-02
ulcerative colitis -1.200 2.2e-07
Waldenstrons macroglobulinemia 1.088 5.1e-03

Synonym

Accession Q8WUM4 C5MQH7 E9PFU1 Q6NUS1 Q9BX86 Q9NUN0 Q9P2H2 Q9UKL5 PDCD6-interacting protein
Symbols AIP1
ALIX
HP95
DRIP4

Gene

PDB (16)

Gene RIF (155)

AA Sequence

MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLR      1 - 70
YYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNL     71 - 140
DNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKD    141 - 210
AIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHA    211 - 280
AELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQK    281 - 350
FTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTK    351 - 420
SRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRA    421 - 490
EGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLD    491 - 560
EVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQ    561 - 630
VSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKT    631 - 700
ERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPS    701 - 770
ATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQS    771 - 840
PGQAPYPGPQQPSYPFPQPPQQSYYPQQ                                              841 - 868
//

Text Mined References (168)

PMID Year Title