Property Summary

NCBI Gene PubMed Count 34
PubMed Score 21.94
PubTator Score 11.69

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.03104319501127E-7
medulloblastoma, large-cell 6234 5.07744801330806E-5
dermatomyositis 967 1.32774916894979E-4
group 4 medulloblastoma 1875 1.52521750539026E-4
ovarian cancer 8492 0.00283565182976826
lung cancer 4473 0.00444581841138559


  Differential Expression (6)

Disease log2 FC p
osteosarcoma 2.047 0.000
group 4 medulloblastoma 1.200 0.000
medulloblastoma, large-cell 1.800 0.000
lung cancer 1.200 0.004
ovarian cancer 1.400 0.003
dermatomyositis 1.400 0.000


Accession Q8WUM0 B2RAZ8 Q5T8N0 Q9H9W2 Q9NV71 Q9NVC4
Symbols hNUP133



1XKS   3CQC   3CQG   3I4R   5A9Q  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (8)

20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19674973 Data present crystal structures of yNup170(979-1502) and hNup107(658-925) x hNup133(517-1156), and conservation of domain arrangement and of tertiary structure suggests that Nup157/170 and Nup133 derived from a common ancestor.
18597806 Mermaid (NUP133) shares glycan specificity with DC-SIGN and inhibits the interaction between DC-SIGN and HIV-1 gp120
18570875 The significant topological differences between Nup107 and Nup133 suggest that helical nucleoporin domains of the nuclear pore complex scaffold fall in different classes and fulfill largely nonredundant functions.
18187620 Knockdown of nucleoporin 133kDa (NUP133) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17768364 When complexed with NUP107, this complex will give the first insights into the protein-protein interactions within a core module of the nuclear pore complex.
15557116 human Nup133 contains two domains: a COOH-terminal domain responsible for its interaction with its subcomplex through Nup107; and an NH2-terminal domain whose crystal structure reveals a seven-bladed beta-propeller.

AA Sequence

EVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQI                                     1121 - 1156

Text Mined References (48)

PMID Year Title
27194810 2016 Systematic Protein-Protein Interaction Analysis Reveals Intersubcomplex Contacts in the Nuclear Pore Complex.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26411495 2015 Biallelic Mutations in Nuclear Pore Complex Subunit NUP107 Cause Early-Childhood-Onset Steroid-Resistant Nephrotic Syndrome.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24315095 2013 Integrated structural analysis of the human nuclear pore complex scaffold.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.