Property Summary

NCBI Gene PubMed Count 34
PubMed Score 22.84
PubTator Score 11.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 5.1e-05
dermatomyositis 966 1.3e-04
osteosarcoma 7950 2.0e-04
ovarian cancer 8520 2.8e-03
group 3 medulloblastoma 4104 4.4e-03
lung cancer 4740 4.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Galloway-Mowat syndrome 15 5.163 2.6

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis 1.400 1.3e-04
group 3 medulloblastoma 1.100 4.4e-03
lung cancer 1.200 4.4e-03
medulloblastoma, large-cell 1.800 5.1e-05
osteosarcoma -1.290 2.0e-04
ovarian cancer 1.400 2.8e-03

Protein-protein Interaction (9)

Gene RIF (9)

AA Sequence

MFPAAPSPRTPGTGSRRGPLAGLGPGSTPRTASRKGLPLGSAVSSPVLFSPVGRRSSLSSRGTPTRMFPH      1 - 70
HSITESVNYDVKTFGSSLPVKVMEALTLAEVDDQLTINIDEGGWACLVCKEKLIIWKIALSPITKLSVCK     71 - 140
ELQLPPSDFHWSADLVALSYSSPSGEAHSTQAVAVMVATREGSIRYWPSLAGEDTYTEAFVDSGGDKTYS    141 - 210
FLTAVQGGSFILSSSGSQLIRLIPESSGKIHQHILPQGQGMLSGIGRKVSSLFGILSPSSDLTLSSVLWD    211 - 280
RERSSFYSLTSSNISKWELDDSSEKHAYSWDINRALKENITDAIWGSESNYEAIKEGVNIRYLDLKQNCD    281 - 350
GLVILAAAWHSADNPCLIYYSLITIEDNGCQMSDAVTVEVTQYNPPFQSEDLILCQLTVPNFSNQTAYLY    351 - 420
NESAVYVCSTGTGKFSLPQEKIVFNAQGDSVLGAGACGGVPIIFSRNSGLVSITSRENVSILAEDLEGSL    421 - 490
ASSVAGPNSESMIFETTTKNETIAQEDKIKLLKAAFLQYCRKDLGHAQMVVDELFSSHSDLDSDSELDRA    491 - 560
VTQISVDLMDDYPASDPRWAESVPEEAPGFSNTSLIILHQLEDKMKAHSFLMDFIHQVGLFGRLGSFPVR    561 - 630
GTPMATRLLLCEHAEKLSAAIVLKNHHSRLSDLVNTAILIALNKREYEIPSNLTPADVFFREVSQVDTIC    631 - 700
ECLLEHEEQVLRDAPMDSIEWAEVVINVNNILKDMLQAASHYRQNRNSLYRREESLEKEPEYVPWTATSG    701 - 770
PGGIRTVIIRQHEIVLKVAYPQADSNLRNIVTEQLVALIDCFLDGYVSQLKSVDKSSNRERYDNLEMEYL    771 - 840
QKRSDLLSPLLSLGQYLWAASLAEKYCDFDILVQMCEQTDNQSRLQRYMTQFADQNFSDFLFRWYLEKGK    841 - 910
RGKLLSQPISQHGQLANFLQAHEHLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALA    911 - 980
SDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKK    981 - 1050
ALDLLEYIDEEEDININDLKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLP   1051 - 1120
EVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQI                                     1121 - 1156
//

Text Mined References (48)

PMID Year Title