Property Summary

NCBI Gene PubMed Count 13
Grant Count 17
R01 Count 10
Funding $1,097,893.01
PubMed Score 22.76
PubTator Score 12.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Gene RIF (3)

PMID Text
26898802 A key role for HIF-2alpha-induced Ptpmt1 up-regulation in proliferation, survival and glucose metabolism of erythroleukemia cells.
24709986 our data support a model in which MK-STYX controls apoptosis by negatively regulating PTPMT1.
23326511 Our data suggest that inhibition of PTPMT1 causes a metabolic crisis in cancer cells that induces cell death, and may be a mechanism by which cancer cells can be sensitized to currently available therapies.

AA Sequence

MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVIT      1 - 70
MNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSA     71 - 140
TMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT             141 - 201
//

Text Mined References (17)

PMID Year Title
26898802 2016 Ptpmt1 induced by HIF-2? regulates the proliferation and glucose metabolism in erythroleukemia cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24709986 2014 The pseudophosphatase MK-STYX physically and genetically interacts with the mitochondrial phosphatase PTPMT1.
23326511 2013 Downregulation of the mitochondrial phosphatase PTPMT1 is sufficient to promote cancer cell death.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...