Property Summary

NCBI Gene PubMed Count 77
PubMed Score 401.84
PubTator Score 144.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 4.8e-02
interstitial cystitis 1.700 2.6e-03
lung cancer -1.500 8.9e-05
lung carcinoma -2.100 3.1e-25
malignant mesothelioma -1.200 1.5e-05
Multiple myeloma 1.387 1.1e-03
osteosarcoma -3.806 2.3e-06
ovarian cancer 1.900 5.7e-06
periodontitis 1.300 5.4e-24

Protein-protein Interaction (3)

Gene RIF (44)

AA Sequence

MATMVPSVLWPRACWTLLVCCLLTPGVQGQEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLS      1 - 70
KELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYRLPERVELAPLPPWQPVGQNFTLRCQ     71 - 140
VEDGSPRTSLTVVLLRWEEELSRQPAVEEPAEVTATVLASRDDHGAPFSCRTELDMQPQGLGLFVNTSAP    141 - 210
RQLRTFVLPVTPPRLVAPRFLEVETSWPVDCTLDGLFPASEAQVYLALGDQMLNATVMNHGDTLTATATA    211 - 280
TARADQEGAREIVCNVTLGGERREARENLTVFSFLGPIVNLSEPTAHEGSTVTVSCMAGARVQVTLDGVP    281 - 350
AAAPGQPAQLQLNATESDDGRSFFCSATLEVDGEFLHRNSSVQLRVLYGPKIDRATCPQHLKWKDKTRHV    351 - 420
LQCQARGNPYPELRCLKEGSSREVPVGIPFFVNVTHNGTYQCQASSSRGKYTLVVVMDIEAGSSHFVPVF    421 - 490
VAVLLTLGVVTIVLALMYVFREHQRSGSYHVREESTYLPLTSMQPTEAMGEEPSRAE                 491 - 547
//

Text Mined References (83)

PMID Year Title