Property Summary

NCBI Gene PubMed Count 28
Grant Count 21
R01 Count 17
Funding $2,516,707.02
PubMed Score 34.00
PubTator Score 23.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -3.200 0.000
ependymoma -1.200 0.014
oligodendroglioma -1.100 0.022
psoriasis 1.600 0.000
glioblastoma -1.400 0.002
cystic fibrosis -1.663 0.000
atypical teratoid/rhabdoid tumor -1.700 0.000
primitive neuroectodermal tumor -1.600 0.018
tuberculosis -2.200 0.003
non-small cell lung cancer 1.908 0.000
intraductal papillary-mucinous carcinoma... 2.100 0.045
intraductal papillary-mucinous neoplasm ... 4.200 0.002
colon cancer 5.300 0.000
lung cancer 4.800 0.000
pancreatic cancer 2.600 0.000
breast carcinoma 1.100 0.004
interstitial cystitis 4.200 0.004
lung adenocarcinoma 1.400 0.000
pediatric high grade glioma -1.600 0.000
invasive ductal carcinoma 2.500 0.015
nasopharyngeal carcinoma -1.100 0.005
inflammatory breast cancer 2.000 0.004
ductal carcinoma in situ 1.600 0.012
ulcerative colitis 4.400 0.000
ovarian cancer 2.800 0.002
pituitary cancer -1.100 0.034

Gene RIF (18)

PMID Text
26518873 Regulation of Hyaluronan (HA) Metabolism Mediated by HYBID (Hyaluronan-binding Protein Involved in HA Depolymerization, KIAA1199) and HA Synthases in Growth Factor-stimulated Fibroblasts.
26437221 CEMIP directly facilitates colon tumor growth, and high CEMIP expression correlates with poor outcome in stage III and in stages II+III combined cohorts.
26045799 We present evidence that high expression of KIAA1199 is associated with tumor invasion depth, TNM stage, and poor prognosis in colorectal cancer
26009875 Results provide insight into the upregulation of CEMIP within cancer and can lead to novel treatment strategies targeting this cancer cell migration-promoting gene.
25366117 oncogenic protein induced by HPV infection and constitutive NF-kappaB activity that transmits pro-survival and invasive signals through EGFR signalling
25051373 KIAA1199 plays an important role in glycogen breakdown and cancer cell survival
24628760 Findings indicate that KIAA1199 may play an important role in breast tumor growth and invasiveness.
24573670 KIAA1199 influences the proliferation, adhesion, motility, invasiveness and epithelial-to-mesenchymal transition of cancer cells, is a likely target gene of the Wnt/beta-catenin signalling pathway[review]
24269685 Results suggest that the N-terminal portion of KIAA1199 functions as a cleavable signal sequence required for proper KIAA1199 translocation and KIAA1199-mediated HAhyaluronan depolymerization.
23990668 KIAA1199 serves as a novel cell migration-promoting gene and plays a critical role in maintaining cancer mesenchymal status.
More...

AA Sequence

MGAAGRQDFLFKAMLTISWLTLTCFPGATSTVAAGCPDQSPELQPWNPGHDQDHHVHIGQGKTLLLTSSA      1 - 70
TVYSIHISEGGKLVIKDHDEPIVLRTRHILIDNGGELHAGSALCPFQGNFTIILYGRADEGIQPDPYYGL     71 - 140
KYIGVGKGGALELHGQKKLSWTFLNKTLHPGGMAEGGYFFERSWGHRGVIVHVIDPKSGTVIHSDRFDTY    141 - 210
RSKKESERLVQYLNAVPDGRILSVAVNDEGSRNLDDMARKAMTKLGSKHFLHLGFRHPWSFLTVKGNPSS    211 - 280
SVEDHIEYHGHRGSAAARVFKLFQTEHGEYFNVSLSSEWVQDVEWTEWFDHDKVSQTKGGEKISDLWKAH    281 - 350
PGKICNRPIDIQATTMDGVNLSTEVVYKKGQDYRFACYDRGRACRSYRVRFLCGKPVRPKLTVTIDTNVN    351 - 420
STILNLEDNVQSWKPGDTLVIASTDYSMYQAEEFQVLPCRSCAPNQVKVAGKPMYLHIGEEIDGVDMRAE    421 - 490
VGLLSRNIIVMGEMEDKCYPYRNHICNFFDFDTFGGHIKFALGFKAAHLEGTELKHMGQQLVGQYPIHFH    491 - 560
LAGDVDERGGYDPPTYIRDLSIHHTFSRCVTVHGSNGLLIKDVVGYNSLGHCFFTEDGPEERNTFDHCLG    561 - 630
LLVKSGTLLPSDRDSKMCKMITEDSYPGYIPKPRQDCNAVSTFWMANPNNNLINCAAAGSEETGFWFIFH    631 - 700
HVPTGPSVGMYSPGYSEHIPLGKFYNNRAHSNYRAGMIIDNGVKTTEASAKDKRPFLSIISARYSPHQDA    701 - 770
DPLKPREPAIIRHFIAYKNQDHGAWLRGGDVWLDSCRFADNGIGLTLASGGTFPYDDGSKQEIKNSLFVG    771 - 840
ESGNVGTEMMDNRIWGPGGLDHSGRTLPIGQNFPIRGIQLYDGPINIQNCTFRKFVALEGRHTSALAFRL    841 - 910
NNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNWL    911 - 980
VRHPDCINVPDWRGAICSGCYAQMYIQAYKTSNLRMKIIKNDFPSHPLYLEGALTRSTHYQQYQPVVTLQ    981 - 1050
KGYTIHWDQTAPAELAIWLINFNKGDWIRVGLCYPRGTTFSILSDVHNRLLKQTSKTGVFVRTLQMDKVE   1051 - 1120
QSYPGRSHYYWDEDSGLLFLKLKAQNEREKFAFCSMKGCERIKIKALIPKNAGVSDCTATAYPKFTERAV   1121 - 1190
VDVPMPKKLFGSQLKTKDHFLEVKMESSKQHFFHLWNDFAYIEVDGKKYPSSEDGIQVVVIDGNQGRVVS   1191 - 1260
HTSFRNSILQGIPWQLFNYVATIPDNSIVLMASKGRYVSRGPWTRVLEKLGADRGLKLKEQMAFVGFKGS   1261 - 1330
FRPIWVTLDTEDHKAKIFQVVPIPVVKKKKL                                          1331 - 1361
//

Text Mined References (29)

PMID Year Title
26518873 2015 Regulation of Hyaluronan (HA) Metabolism Mediated by HYBID (Hyaluronan-binding Protein Involved in HA Depolymerization, KIAA1199) and HA Synthases in Growth Factor-stimulated Fibroblasts.
26437221 2015 Induction of KIAA1199/CEMIP is associated with colon cancer phenotype and poor patient survival.
26045799 2015 Association between KIAA1199 overexpression and tumor invasion, TNM stage, and poor prognosis in colorectal cancer.
26009875 2015 Hypoxia promotes colon cancer dissemination through up-regulation of cell migration-inducing protein (CEMIP).
25366117 2014 NF-?B-induced KIAA1199 promotes survival through EGFR signalling.
25350695 2014 Pharmacogenetic meta-analysis of genome-wide association studies of LDL cholesterol response to statins.
25051373 2014 KIAA1199 interacts with glycogen phosphorylase kinase ?-subunit (PHKB) to promote glycogen breakdown and cancer cell survival.
24628760 2014 Functional proteomic analysis reveals the involvement of KIAA1199 in breast cancer growth, motility and invasiveness.
24573670 2014 KIAA1199 and its biological role in human cancer and cancer cells (review).
24269685 2014 N-Terminal signal sequence is required for cellular trafficking and hyaluronan-depolymerization of KIAA1199.
More...