Property Summary

NCBI Gene PubMed Count 33
PubMed Score 41.54
PubTator Score 23.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 1.9e-04
Breast cancer 1.900 2.3e-07
breast carcinoma 1.100 3.7e-03
colon cancer 4.000 4.2e-04
cystic fibrosis -1.663 3.2e-04
ductal carcinoma in situ 1.600 1.2e-02
ependymoma -1.200 1.4e-02
glioblastoma -1.200 1.0e-03
interstitial cystitis 4.200 4.3e-03
intraductal papillary-mucinous carcinoma... 2.100 4.5e-02
intraductal papillary-mucinous neoplasm ... 4.200 2.4e-03
invasive ductal carcinoma 1.686 2.3e-03
lung adenocarcinoma 1.200 3.3e-06
lung cancer 2.300 1.5e-04
malignant mesothelioma -3.200 2.4e-08
nasopharyngeal carcinoma -1.100 4.8e-03
non-small cell lung cancer 1.908 1.7e-09
oligodendroglioma -1.100 2.2e-02
ovarian cancer 2.800 1.9e-03
pancreatic cancer 2.600 1.8e-06
pediatric high grade glioma -1.600 6.4e-05
pituitary cancer -1.100 3.4e-02
primitive neuroectodermal tumor -1.600 1.8e-02
psoriasis 1.400 1.2e-03
tuberculosis -2.200 3.2e-03
ulcerative colitis 4.400 1.6e-05

Gene RIF (22)

AA Sequence

MGAAGRQDFLFKAMLTISWLTLTCFPGATSTVAAGCPDQSPELQPWNPGHDQDHHVHIGQGKTLLLTSSA      1 - 70
TVYSIHISEGGKLVIKDHDEPIVLRTRHILIDNGGELHAGSALCPFQGNFTIILYGRADEGIQPDPYYGL     71 - 140
KYIGVGKGGALELHGQKKLSWTFLNKTLHPGGMAEGGYFFERSWGHRGVIVHVIDPKSGTVIHSDRFDTY    141 - 210
RSKKESERLVQYLNAVPDGRILSVAVNDEGSRNLDDMARKAMTKLGSKHFLHLGFRHPWSFLTVKGNPSS    211 - 280
SVEDHIEYHGHRGSAAARVFKLFQTEHGEYFNVSLSSEWVQDVEWTEWFDHDKVSQTKGGEKISDLWKAH    281 - 350
PGKICNRPIDIQATTMDGVNLSTEVVYKKGQDYRFACYDRGRACRSYRVRFLCGKPVRPKLTVTIDTNVN    351 - 420
STILNLEDNVQSWKPGDTLVIASTDYSMYQAEEFQVLPCRSCAPNQVKVAGKPMYLHIGEEIDGVDMRAE    421 - 490
VGLLSRNIIVMGEMEDKCYPYRNHICNFFDFDTFGGHIKFALGFKAAHLEGTELKHMGQQLVGQYPIHFH    491 - 560
LAGDVDERGGYDPPTYIRDLSIHHTFSRCVTVHGSNGLLIKDVVGYNSLGHCFFTEDGPEERNTFDHCLG    561 - 630
LLVKSGTLLPSDRDSKMCKMITEDSYPGYIPKPRQDCNAVSTFWMANPNNNLINCAAAGSEETGFWFIFH    631 - 700
HVPTGPSVGMYSPGYSEHIPLGKFYNNRAHSNYRAGMIIDNGVKTTEASAKDKRPFLSIISARYSPHQDA    701 - 770
DPLKPREPAIIRHFIAYKNQDHGAWLRGGDVWLDSCRFADNGIGLTLASGGTFPYDDGSKQEIKNSLFVG    771 - 840
ESGNVGTEMMDNRIWGPGGLDHSGRTLPIGQNFPIRGIQLYDGPINIQNCTFRKFVALEGRHTSALAFRL    841 - 910
NNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNWL    911 - 980
VRHPDCINVPDWRGAICSGCYAQMYIQAYKTSNLRMKIIKNDFPSHPLYLEGALTRSTHYQQYQPVVTLQ    981 - 1050
KGYTIHWDQTAPAELAIWLINFNKGDWIRVGLCYPRGTTFSILSDVHNRLLKQTSKTGVFVRTLQMDKVE   1051 - 1120
QSYPGRSHYYWDEDSGLLFLKLKAQNEREKFAFCSMKGCERIKIKALIPKNAGVSDCTATAYPKFTERAV   1121 - 1190
VDVPMPKKLFGSQLKTKDHFLEVKMESSKQHFFHLWNDFAYIEVDGKKYPSSEDGIQVVVIDGNQGRVVS   1191 - 1260
HTSFRNSILQGIPWQLFNYVATIPDNSIVLMASKGRYVSRGPWTRVLEKLGADRGLKLKEQMAFVGFKGS   1261 - 1330
FRPIWVTLDTEDHKAKIFQVVPIPVVKKKKL                                          1331 - 1361
//

Text Mined References (34)

PMID Year Title