Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.87
PubTator Score 3.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

AA Sequence

MLRCGGRGLLLGLAVAAAAVMAARLMGWWGPRAGFRLFIPEELSRYRGGPGDPGLYLALLGRVYDVSSGR      1 - 70
RHYEPGSHYSGFAGRDASRAFVTGDCSEAGLVDDVSDLSAAEMLTLHNWLSFYEKNYVCVGRVTGRFYGE     71 - 140
DGLPTPALTQVEAAITRGLEANKLQLQEKQTFPPCNAEWSSARGSRLWCSQKSGGVSRDWIGVPRKLYKP    141 - 210
GAKEPRCVCVRTTGPPSGQMPDNPPHRNRGDLDHPNLAEYTGCPPLAITCSFPL                    211 - 264
//

Text Mined References (12)

PMID Year Title