Property Summary

NCBI Gene PubMed Count 12
PubMed Score 50.26
PubTator Score 18.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 7.8e-05
osteosarcoma 7950 1.5e-04
ovarian cancer 8520 4.0e-04
group 4 medulloblastoma 1855 4.4e-04
Breast cancer 3578 2.5e-02
Disease Target Count Z-score Confidence
Echinococcosis 26 3.745 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 7.8e-05
Breast cancer 3.100 2.5e-02
group 4 medulloblastoma 1.200 4.4e-04
osteosarcoma -1.326 1.5e-04
ovarian cancer 1.600 4.0e-04

Gene RIF (4)

AA Sequence

MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPVLQKHGITHIICIRQNIEAN      1 - 70
FIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHGNAGISRSAAFVIAYIMETFG     71 - 140
MKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTIQMMSPLQIERSLSVHSGTTGSLKRTHEEED    141 - 210
DFGTMQVATAQNG                                                             211 - 223
//

Text Mined References (14)

PMID Year Title