Property Summary

NCBI Gene PubMed Count 10
Grant Count 8
Funding $427,602.83
PubMed Score 45.85
PubTator Score 18.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 2.625 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
Breast cancer 3.100 0.025
group 4 medulloblastoma 1.200 0.000
ovarian cancer 1.600 0.000

Gene RIF (2)

PMID Text
23847209 results identify STYX as an important regulator of ERK1/2 signaling critical for cell migration
19369647 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPVLQKHGITHIICIRQNIEAN      1 - 70
FIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHGNAGISRSAAFVIAYIMETFG     71 - 140
MKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTIQMMSPLQIERSLSVHSGTTGSLKRTHEEED    141 - 210
DFGTMQVATAQNG                                                             211 - 223
//

Text Mined References (12)

PMID Year Title
23847209 2013 Pseudophosphatase STYX modulates cell-fate decisions and cell migration by spatiotemporal regulation of ERK1/2.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19369647 2009 Identification of potentially damaging amino acid substitutions leading to human male infertility.
18058037 2007 Structural genomics of protein phosphatases.
17047026 2006 Non-invasive genetic diagnosis of male infertility using spermatozoal RNA: KLHL10 mutations in oligozoospermic patients impair homodimerization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11842224 2002 The archetype STYX/dead-phosphatase complexes with a spermatid mRNA-binding protein and is essential for normal sperm production.
More...