Property Summary

NCBI Gene PubMed Count 10
PubMed Score 45.85
PubTator Score 18.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 7.81337979892893E-5
osteosarcoma 7933 1.41037978590734E-4
ovarian cancer 8492 4.03087575695348E-4
group 4 medulloblastoma 1875 4.36670731694844E-4
Breast cancer 3099 0.025326131931831
Disease Target Count Z-score Confidence
Echinococcosis 28 3.775 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 2.625 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
Breast cancer 3.100 0.025
group 4 medulloblastoma 1.200 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q8WUJ0 B9EJG0 Q99850
Symbols

Gene

PDB

2R0B  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
23847209 results identify STYX as an important regulator of ERK1/2 signaling critical for cell migration
19369647 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPVLQKHGITHIICIRQNIEAN      1 - 70
FIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHGNAGISRSAAFVIAYIMETFG     71 - 140
MKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTIQMMSPLQIERSLSVHSGTTGSLKRTHEEED    141 - 210
DFGTMQVATAQNG                                                             211 - 223
//

Text Mined References (12)

PMID Year Title
23847209 2013 Pseudophosphatase STYX modulates cell-fate decisions and cell migration by spatiotemporal regulation of ERK1/2.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19369647 2009 Identification of potentially damaging amino acid substitutions leading to human male infertility.
18058037 2007 Structural genomics of protein phosphatases.
17047026 2006 Non-invasive genetic diagnosis of male infertility using spermatozoal RNA: KLHL10 mutations in oligozoospermic patients impair homodimerization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11842224 2002 The archetype STYX/dead-phosphatase complexes with a spermatid mRNA-binding protein and is essential for normal sperm production.
More...