Property Summary

NCBI Gene PubMed Count 76
Grant Count 65
R01 Count 53
Funding $5,313,112.97
PubMed Score 100.31
PubTator Score 75.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.257 0.002

Gene

PANTHER Protein Class (2)

PDB

3C0Y   3C0Z   3C10   3ZNR   3ZNS  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651907 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC7

Gene RIF (45)

PMID Text
26469385 HIV-1 MA downregulates HDAC7 gene expression in HepG2 cells
26272600 This study demonstrated a simple and straightforward method of quantifying proneural/mesenchymal markers in glioblastoma. Of note, HDAC7 expression might be a novel therapeutic target in glioblastoma treatment.
25511694 identify a new target of ROCK signaling via myosin phosphatase subunit (MYPT1) and histone deacetylase (HDAC7) at the nuclear level
25173798 Study identifies the miR-34a-HDAC1/HDAC7-HSP70 K246 axis as a novel molecular signature predictive of therapy resistance.
24239178 The transcriptional function of HCS was shown by in vitro pull down and in vivo co-immunoprecipitation assays to depend on its interaction with the histone deacetylases HDAC1, HDAC2 and HDAC7
24189120 endothelial progenitor cells involved in the angiogenesis might be controlled by VEGF-PKD1-HDAC7 axis, which regulates the EPCs angiogenesis by PKD1, but not the ERK and PI3K pathway
23891737 Expression of JHDM2A was significantly increased but HDAC2, HDAC7, and SUV39H2 were significantly down-regulated in Systemic Sclerosis B cells relative to controls
23880157 Authors identified acetyltransferase p300 and deacetylase HDAC7 as enzymes modulating human T cell leukemia virus type 1 Tax protein acetylation.
23853092 Histone deacetylase 7 promotes Toll-like receptor 4-dependent proinflammatory gene expression in macrophages.
23696748 Our findings uncover a novel role for HDAC7 in maintaining the identity of a particular cell type by silencing lineage-inappropriate genes.
More...

AA Sequence

MDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLL      1 - 70
HKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSL     71 - 140
PSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCS    141 - 210
SPNDSEHGPNPILGSEALLGQRLRLQETSVAPFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPRGPI    211 - 280
LGSPHTPLFLPHGLEPEAGGTLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLH    281 - 350
WPLSRTRSEPLPPSATAPPPPGPMQPRLEQLKTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQVV    351 - 420
DDGLEHRELGHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGHRPLSRAQSSPAA    421 - 490
PASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGL    491 - 560
RSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWN    561 - 630
ELHSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASK    631 - 700
ILIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMG    701 - 770
DPEYLAAFRIVVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALE    771 - 840
GGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQRLASCPDSWVP    841 - 910
RVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL                                911 - 952
//

Text Mined References (86)

PMID Year Title
26272600 2015 Detection of proneural/mesenchymal marker expression in glioblastoma: temporospatial dynamics and association with chromatin-modifying gene expression.
25511694 2015 Rho-kinase signaling controls nucleocytoplasmic shuttling of class IIa histone deacetylase (HDAC7) and transcriptional activation of orphan nuclear receptor NR4A1.
25416956 2014 A proteome-scale map of the human interactome network.
25411248 2015 ?-Actinin 4 potentiates nuclear factor ?-light-chain-enhancer of activated B-cell (NF-?B) activity in podocytes independent of its cytoplasmic actin binding function.
25173798 2014 MiR-34a regulates therapy resistance by targeting HDAC1 and HDAC7 in breast cancer.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24239178 2014 Holocarboxylase synthetase acts as a biotin-independent transcriptional repressor interacting with HDAC1, HDAC2 and HDAC7.
24189120 2014 VEGF-PKD1-HDAC7 signaling promotes endothelial progenitor cell migration and tube formation.
23891737 2013 Aberrant histone modification in peripheral blood B cells from patients with systemic sclerosis.
More...