Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.20
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ulcerative colitis 2087 9.86835690353523E-6
ovarian cancer 8492 0.00130399937363223
active Crohn's disease 918 0.00189465346211692
medulloblastoma, large-cell 6234 0.0102619499263748
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0175715041511081
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell -1.300 0.010
pancreatic ductal adenocarcinoma liver m... -1.932 0.018
active Crohn's disease 2.103 0.002
ulcerative colitis 1.600 0.000
ovarian cancer -1.500 0.001

Synonym

Accession Q8WUH6 B3KMN9
Symbols C12orf23

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG

AA Sequence

MNQTDKNQQEIPSYLNDEPPEGSMKDHPQQQPGMLSRVTGGIFSVTKGAVGATIGGVAWIGGKSLEVTKT      1 - 70
AVTTVPSMGIGLVKGGVSAVAGGVTAVGSAVVNKVPLTGKKKDKSD                             71 - 116
//

Text Mined References (8)

PMID Year Title
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.