Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.38
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 2.103 1.9e-03
active ulcerative colitis 1.443 3.3e-03
medulloblastoma, large-cell -1.300 1.0e-02
ovarian cancer -1.500 1.3e-03
pancreatic ductal adenocarcinoma liver m... -1.932 1.8e-02

Synonym

Accession Q8WUH6 B3KMN9
Symbols C12orf23

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MNQTDKNQQEIPSYLNDEPPEGSMKDHPQQQPGMLSRVTGGIFSVTKGAVGATIGGVAWIGGKSLEVTKT      1 - 70
AVTTVPSMGIGLVKGGVSAVAGGVTAVGSAVVNKVPLTGKKKDKSD                             71 - 116
//

Text Mined References (8)

PMID Year Title