Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.60
PubTator Score 6.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
CHARGE syndrome 26 3.055 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.100 2.8e-03
glioblastoma -1.100 1.6e-03
intraductal papillary-mucinous adenoma (... 1.300 9.4e-03
invasive ductal carcinoma -1.100 4.6e-03
ovarian cancer -1.400 2.1e-07
tuberculosis 2.200 1.5e-09

Synonym

Accession Q8WUF8 B2R7C6 B4DJ14 B4DLG5 Q9H0U8
Symbols C5orf21

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (10)

AA Sequence

MSISLSSLILLPIWINMAQIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPPLDFPDTLEGFEYAFNEK      1 - 70
GQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITKYVYELLEKDCNLKKVSIPVDATESEPKSFIFMS     71 - 140
EDALTNPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQIPFIKRAVAEGYGVIVLNPNENYIEVEKPK    141 - 210
IHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENGSPEEHAIYVWDHFIA    211 - 280
QAAAENVFFVAHSYGGLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSS    281 - 350
EPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKTSSLKPAVTRRSHRIKHEEL        351 - 416
//

Text Mined References (20)

PMID Year Title