Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.37
PubTator Score 6.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -1.100 0.002
tuberculosis 2.200 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.009
diabetes mellitus -1.100 0.003
invasive ductal carcinoma -1.100 0.005
ovarian cancer -1.400 0.000

Gene RIF (8)

PMID Text
26676844 Our results showed that FAM172A could suppress proliferation of colon cancer cells, and STAT1 could bind to the minimum promoter region of FAM172A and upregulated the expression of FAM172A
26573560 FAM172A protein is expressed at high levels in human papillary thyroid carcinoma, which may promote cell proliferation via activation of the p38 MAPK signaling pathway.
23314443 FAM172A may be a novel tumor-suppressor gene that plays an important role in cell cycle mediated, at least partially, by the Notch 3 signaling pathway.
21092515 FAM172A protein promotes cell proliferation, inhibits cell apoptosis and facilitates S-phase entry in HEK293 cells.
20818486 FAM172 protein expression in human aortic smooth muscle cells was up-regulated by high glucose levels in a concentration-dependent and time-course manner.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20137623 The changes of C5orf21 gene expression are correlated with diabetic macroangiopathy.
18854154 Knockdown of family with sequence similarity 172, member A (C5orf21; FAM172A) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MSISLSSLILLPIWINMAQIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPPLDFPDTLEGFEYAFNEK      1 - 70
GQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITKYVYELLEKDCNLKKVSIPVDATESEPKSFIFMS     71 - 140
EDALTNPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQIPFIKRAVAEGYGVIVLNPNENYIEVEKPK    141 - 210
IHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENGSPEEHAIYVWDHFIA    211 - 280
QAAAENVFFVAHSYGGLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSS    281 - 350
EPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKTSSLKPAVTRRSHRIKHEEL        351 - 416
//

Text Mined References (18)

PMID Year Title
26676844 2016 FAM172A modulates apoptosis and proliferation of colon cancer cells via STAT1 binding to its promoter.
26573560 2016 FAM172A protein promotes the proliferation of human papillary thyroid carcinoma cells via the p38 mitogen-activated protein kinase pathway.
23314443 2013 FAM172A induces S phase arrest of HepG2 cells via Notch 3.
21092515 2010 [Effect of FAM172A protein on apoptosis and proliferation in HEK293 cells].
20818486 2010 Identification of the novel protein FAM172A, and its up-regulation by high glucose in human aortic smooth muscle cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20137623 2009 [Molecular cloning of a novel gene, C5orf21 gene and its roles in diabetic macroangiopathy].
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...