Property Summary

NCBI Gene PubMed Count 7
PubMed Score 23.47
PubTator Score 100.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
aldosterone-producing adenoma -1.552 1.2e-02
atypical teratoid / rhabdoid tumor -1.100 6.6e-04
Breast cancer -1.200 1.7e-04
group 3 medulloblastoma -1.700 5.5e-05
interstitial cystitis -1.300 6.4e-04
intraductal papillary-mucinous adenoma (... 1.500 7.4e-03
intraductal papillary-mucinous neoplasm ... 1.500 2.3e-02
lung adenocarcinoma -1.100 2.0e-09
lung carcinoma -1.600 1.1e-23
medulloblastoma, large-cell -1.500 1.9e-03
non-small cell lung cancer -1.126 2.4e-12
osteosarcoma -1.176 3.9e-03
psoriasis -1.800 1.3e-09
Rheumatoid arthritis 1.200 1.8e-02
ulcerative colitis -1.200 6.2e-06
Waldenstrons macroglobulinemia 1.153 5.6e-03

Gene RIF (2)

AA Sequence

MAAGAGAGSAPRWLRALSEPLSAAQLRRLEEHRYSAAGVSLLEPPLQLYWTWLLQWIPLWMAPNSITLLG      1 - 70
LAVNVVTTLVLISYCPTATEEAPYWTYLLCALGLFIYQSLDAIDGKQARRTNSCSPLGELFDHGCDSLST     71 - 140
VFMAVGASIAARLGTYPDWFFFCSFIGMFVFYCAHWQTYVSGMLRFGKVDVTEIQIALVIVFVLSAFGGA    141 - 210
TMWDYTIPILEIKLKILPVLGFLGGVIFSCSNYFHVILHGGVGKNGSTIAGTSVLSPGLHIGLIIILAIM    211 - 280
IYKKSATDVFEKHPCLYILMFGCVFAKVSQKLVVAHMTKSELYLQDTVFLGPGLLFLDQYFNNFIDEYVV    281 - 350
LWMAMVISSFDMVIYFSALCLQISRHLHLNIFKTACHQAPEQVQVLSSKSHQNNMD                  351 - 406
//

Text Mined References (11)

PMID Year Title