Property Summary

NCBI Gene PubMed Count 7
PubMed Score 23.47
PubTator Score 100.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 1.07380945795091E-23
lung adenocarcinoma 2714 3.39350176557162E-17
non-small cell lung cancer 2798 2.41055384017639E-12
psoriasis 6685 1.28660907608439E-9
group 4 medulloblastoma 1875 5.41367326240261E-5
medulloblastoma, large-cell 6234 6.93548431928339E-5
ulcerative colitis 2087 9.51635452502487E-5
interstitial cystitis 2299 6.40064572081189E-4
inflammatory breast cancer 404 0.00285556988711366
atypical teratoid / rhabdoid tumor 4369 0.00377607901842907
Waldenstrons macroglobulinemia 765 0.00564457437462015
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00739549541572648
aldosterone-producing adenoma 664 0.0122005849593337
Rheumatoid Arthritis 1171 0.0177910623188031
osteosarcoma 7933 0.0188096395111987
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0258349753424817
Disease Target Count Z-score Confidence
Newborn respiratory distress syndrome 11 4.027 2.0
Disease Target Count
Spermatogenesis arrest 2

Expression

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA Inparanoid
C. elegans OMA EggNOG

Gene RIF (2)

PMID Text
24639073 Data suggest that PAF-CPT level in blood can be altered by diet; up-regulation of PAF-CPT is associated with diets high in fat and cholesterol; down-regulation of PAF-CPT is associated with healthy diet patterns of the population studied in Greece.
15936720 Furthermore, the activity of CPT in forming PC is increased in the breast cancer cell lines cultured for 24 h.

AA Sequence

MAAGAGAGSAPRWLRALSEPLSAAQLRRLEEHRYSAAGVSLLEPPLQLYWTWLLQWIPLWMAPNSITLLG      1 - 70
LAVNVVTTLVLISYCPTATEEAPYWTYLLCALGLFIYQSLDAIDGKQARRTNSCSPLGELFDHGCDSLST     71 - 140
VFMAVGASIAARLGTYPDWFFFCSFIGMFVFYCAHWQTYVSGMLRFGKVDVTEIQIALVIVFVLSAFGGA    141 - 210
TMWDYTIPILEIKLKILPVLGFLGGVIFSCSNYFHVILHGGVGKNGSTIAGTSVLSPGLHIGLIIILAIM    211 - 280
IYKKSATDVFEKHPCLYILMFGCVFAKVSQKLVVAHMTKSELYLQDTVFLGPGLLFLDQYFNNFIDEYVV    281 - 350
LWMAMVISSFDMVIYFSALCLQISRHLHLNIFKTACHQAPEQVQVLSSKSHQNNMD                  351 - 406
//

Text Mined References (11)

PMID Year Title
24639073 2015 The relation of diet with PAF and its metabolic enzymes in healthy volunteers.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16292752 2005 Inhibition of cholinephosphotransferase activity in lung injury induced by 2-chloroethyl ethyl sulfide, a mustard analog.
15936720 2005 Modulation of cholinephosphotransferase activity in breast cancer cell lines by Ro5-4864, a peripheral benzodiazepine receptor agonist.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359261 2002 Differential expression of cholinephosphotransferase in normal and cancerous human mammary epithelial cells.
12221122 2002 The major sites of cellular phospholipid synthesis and molecular determinants of Fatty Acid and lipid head group specificity.
More...