Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.49
PubTator Score 2.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.9e-03

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.400 1.9e-03

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLK      1 - 70
KRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIR     71 - 140
ERLKGQEDSLASAVDAATEQKTCDSD                                                141 - 166
//

Text Mined References (16)

PMID Year Title