Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.57
PubTator Score 3.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.103 0.002
group 3 medulloblastoma 1.100 0.001
acute myeloid leukemia 1.400 0.020
ovarian cancer -1.700 0.000

Synonym

Accession Q8WUD1 B2RD03 D3DS24 Q6NZ33
Symbols

Gene

PDB

2A5J  

 GO Function (1)

Gene RIF (1)

PMID Text
26209634 Data show that Rab2B and a Rab2B-specific effector, GARI-L4, regulate Golgi morphology.

AA Sequence

MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRS      1 - 70
ITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFARE     71 - 140
HGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIG    141 - 210
SNSGCC                                                                    211 - 216
//

Text Mined References (12)

PMID Year Title
26209634 2015 Small GTPase Rab2B and Its Specific Binding Protein Golgi-associated Rab2B Interactor-like 4 (GARI-L4) Regulate Golgi Morphology.
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19966785 2010 Rab27a and Rab27b control different steps of the exosome secretion pathway.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...