Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.12
PubTator Score 3.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia 1.400 2.0e-02
group 3 medulloblastoma 1.100 6.4e-04
ovarian cancer -1.700 3.8e-09
primary pancreatic ductal adenocarcinoma 1.103 2.4e-03

Gene RIF (1)

AA Sequence

MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRS      1 - 70
ITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFARE     71 - 140
HGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIG    141 - 210
SNSGCC                                                                    211 - 216
//

Text Mined References (12)

PMID Year Title