Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.57
PubTator Score 3.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.80556990020011E-9
group 3 medulloblastoma 2254 6.42306635321595E-4
primary pancreatic ductal adenocarcinoma 1271 0.00237976978883502
acute myeloid leukemia 785 0.02047743499041
Disease Target Count Z-score Confidence
Oculocerebrorenal syndrome 24 4.222 2.1
Duane retraction syndrome 10 3.033 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.103 0.002
group 3 medulloblastoma 1.100 0.001
acute myeloid leukemia 1.400 0.020
ovarian cancer -1.700 0.000

Synonym

Accession Q8WUD1 B2RD03 D3DS24 Q6NZ33
Symbols

Gene

PDB

2A5J  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Xenopus OMA Inparanoid

 GO Function (1)

Gene RIF (1)

PMID Text
26209634 Data show that Rab2B and a Rab2B-specific effector, GARI-L4, regulate Golgi morphology.

AA Sequence

MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRS      1 - 70
ITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFARE     71 - 140
HGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIG    141 - 210
SNSGCC                                                                    211 - 216
//

Text Mined References (12)

PMID Year Title
26209634 2015 Small GTPase Rab2B and Its Specific Binding Protein Golgi-associated Rab2B Interactor-like 4 (GARI-L4) Regulate Golgi Morphology.
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19966785 2010 Rab27a and Rab27b control different steps of the exosome secretion pathway.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...