Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.49
PubTator Score 11.30

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma -1.405 1.6e-03
group 3 medulloblastoma 1.400 1.7e-05
malignant mesothelioma 2.100 1.0e-07
ovarian cancer -1.500 2.8e-04
primary pancreatic ductal adenocarcinoma 1.020 6.9e-03

Gene RIF (5)

AA Sequence

MAAAAGPGAALSPRPCDSDPATPGAQSPKDDNEDNSNDGTQPSKRRRMGSGDSSRSCETSSQDLGFSYYP      1 - 70
AENLIEYKWPPDETGEYYMLQEQVSEYLGVTSFKRKYPDLERRDLSHKEKLYLRELNVITETQCTLGLTA     71 - 140
LRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQNTQKVEASKVPEYIKKAAKKAAEF    141 - 210
NSNLNRERMEERRAYFDLQTHVIQVPQGKYKVLPTERTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLN    211 - 280
TALYEPPLDPELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKA    281 - 350
ATPRKDGPKRSVLSKSVPGYKPKVIPNAICGICLKGKESNKKGKAESLIHCSQCENSGHPSCLDMTMELV    351 - 420
SMIKTYPWQCMECKTCIICGQPHHEEEMMFCDMCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGR    421 - 490
RGKNSKEG                                                                  491 - 498
//

Text Mined References (30)

PMID Year Title