Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
posterior fossa group A ependymoma 1511 9.78107605583972E-11
lung cancer 4473 0.0016928410995221
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00190664730010077
mucosa-associated lymphoid tissue lymphoma 480 0.00813827614371501
astrocytic glioma 2241 0.0363350918692379
gastric carcinoma 832 0.0410695356686113

Expression

Synonym

Accession Q8WUB2 A6NH30 Q99776
Symbols C12orf24
HSU79274

Gene

  Ortholog (8)

AA Sequence

MLGQLLPHTARGLGAAEMPGQGPGSDWTERSSSAEPPAVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKV      1 - 70
NSHIAKLQELWKTPQNQTIHLSKSMMEASFFKHPDLTTGQKRYLCSIAKIYNANYLKMLMKRQYMHVLQH     71 - 140
SSQKPGVLTHHRSRLSSRYSQKQHYPCTTWRHQLEREDSGSSDIAAASAPEMLIQHSLWRPVRNKEGIKT    141 - 210
GYASKTRCKSLKIFRRPRKLFMQTVSSDDSESHMSEEKKEEDLLNNFMQSMSIEEQGEHLMLT           211 - 273
//

Text Mined References (6)

PMID Year Title
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.