Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.300 3.6e-02
ependymoma -1.100 1.5e-04
gastric carcinoma 1.200 4.1e-02
intraductal papillary-mucinous adenoma (... -1.300 1.9e-03
lung cancer 1.300 1.4e-02
mucosa-associated lymphoid tissue lympho... -1.238 8.1e-03

AA Sequence

MLGQLLPHTARGLGAAEMPGQGPGSDWTERSSSAEPPAVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKV      1 - 70
NSHIAKLQELWKTPQNQTIHLSKSMMEASFFKHPDLTTGQKRYLCSIAKIYNANYLKMLMKRQYMHVLQH     71 - 140
SSQKPGVLTHHRSRLSSRYSQKQHYPCTTWRHQLEREDSGSSDIAAASAPEMLIQHSLWRPVRNKEGIKT    141 - 210
GYASKTRCKSLKIFRRPRKLFMQTVSSDDSESHMSEEKKEEDLLNNFMQSMSIEEQGEHLMLT           211 - 273
//

Text Mined References (6)

PMID Year Title