Property Summary

NCBI Gene PubMed Count 11
PubMed Score 441.69
PubTator Score 554.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.100 1.0e-04
atypical teratoid / rhabdoid tumor 1.500 3.9e-08
fibroadenoma -1.100 4.4e-02
glioblastoma 1.100 1.0e-07
medulloblastoma 1.100 1.4e-07
medulloblastoma, large-cell 1.600 3.8e-05
non-small cell lung cancer 1.192 1.2e-16
pancreatic ductal adenocarcinoma liver m... -2.364 5.5e-04
pituitary cancer -1.100 2.2e-05

Gene RIF (2)

AA Sequence

MPWPLLLLLAVSGAQTTRPCFPGCQCEVETFGLFDSFSLTRVDCSGLGPHIMPVPIPLDTAHLDLSSNRL      1 - 70
EMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGLTALPAESFTSSPLSDVNLSH     71 - 140
NQLREVSVSAFTTHSQGRALHVDLSHNLIHRLVPHPTRAGLPAPTIQSLNLAWNRLHAVPNLRDLPLRYL    141 - 210
SLDGNPLAVIGPGAFAGLGGLTHLSLASLQRLPELAPSGFRELPGLQVLDLSGNPKLNWAGAEVFSGLSS    211 - 280
LQELDLSGTNLVPLPEALLLHLPALQSVSVGQDVRCRRLVREGTYPRRPGSSPKVALHCVDTRDSAARGP    281 - 350
TIL                                                                       351 - 353
//

Text Mined References (12)

PMID Year Title