Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.72
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 1.8e-06
psoriasis 6694 3.4e-04
osteosarcoma 7950 4.0e-04
Breast cancer 3577 4.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -2.600 4.5e-02
osteosarcoma -1.164 4.0e-04
psoriasis 1.700 3.4e-04
tuberculosis 1.300 1.8e-06

Gene RIF (4)

AA Sequence

MASDGARKQFWKRSNSKLPGSIQHVYGAQHPPFDPLLHGTLLRSTAKMPTTPVKAKRVSTFQEFESNTSD      1 - 70
AWDAGEDDDELLAMAAESLNSEVVMETANRVLRNHSQRQGRPTLQEGPGLQQKPRPEAEPPSPPSGDLRL     71 - 140
VKSVSESHTSCPAESASDAAPLQRSQSLPHSATVTLGGTSDPSTLSSSALSEREASRLDKFKQLLAGPNT    141 - 210
DLEELRRLSWSGIPKPVRPMTWKLLSGYLPANVDRRPATLQRKQKEYFAFIEHYYDSRNDEVHQDTYRQI    211 - 280
HIDIPRMSPEALILQPKVTEIFERILFIWAIRHPASGYVQGINDLVTPFFVVFICEYIEAEEVDTVDVSG    281 - 350
VPAEVLCNIEADTYWCMSKLLDGIQDNYTFAQPGIQMKVKMLEELVSRIDEQVHRHLDQHEVRYLQFAFR    351 - 420
WMNNLLMREVPLRCTIRLWDTYQSEPDGFSHFHLYVCAAFLVRWRKEILEEKDFQELLLFLQNLPTAHWD    421 - 490
DEDISLLLAEAYRLKFAFADAPNHYKK                                               491 - 517
//

Text Mined References (21)

PMID Year Title