Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.03
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
aldosterone-producing adenoma -1.043 2.8e-02
diabetes mellitus -1.400 1.5e-03
ependymoma 1.100 4.2e-06
group 3 medulloblastoma 1.100 3.4e-02
ovarian cancer 1.200 6.7e-04
primitive neuroectodermal tumor 1.200 9.4e-04

Gene RIF (1)

AA Sequence

MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTGRGGESIFGQL      1 - 70
YGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMDIIKKIN     71 - 140
ETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPEPTREQLDSGRIGADEEIDDFKGRSAEEVEE    141 - 210
IKAEKEAKTQAILLEMVGDLPDADIKPPENVLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVIRDWKTGES    211 - 280
LCYAFIEFEKEEDCEKAFFKMDNVLIDDRRIHVDFSQSVAKVKWKGKGGKYTKSDFKEYEKEQDKPPNLV    281 - 350
LKDKVKPKQDTKYDLILDEQAEDSKSSHSHTSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHY    351 - 420
EEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLYERERSKKRDRSRSPKKSKDKEKSK    421 - 490
YR                                                                        491 - 492
//

Text Mined References (21)

PMID Year Title