Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.17
PubTator Score 6.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 8.6e-04
diabetes mellitus -1.300 2.4e-02
ependymoma -1.200 2.2e-07
group 3 medulloblastoma -1.200 5.3e-03
interstitial cystitis 1.100 8.2e-03
medulloblastoma, large-cell -1.200 1.7e-05
osteosarcoma -1.797 1.7e-03
pancreatic ductal adenocarcinoma liver m... -1.039 4.5e-03
ulcerative colitis 1.400 1.5e-03

Gene RIF (5)

AA Sequence

MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNL      1 - 70
DQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDK     71 - 140
WKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQLPRKSSPKSTAPVMDLLGLDAPVACSIANSKTSNTLEKD    141 - 210
LDLLASVPSPSSSGSRKVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQTPQMP    211 - 280
TQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPAGYMGGMQASMMGV    281 - 350
PNGMMTTQQAGYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGNGQAAN    351 - 420
QTLSPQMWK                                                                 421 - 429
//

Text Mined References (22)

PMID Year Title