Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.17
PubTator Score 6.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.797 0.002
ependymoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.300 0.001
group 3 medulloblastoma -1.200 0.005
medulloblastoma, large-cell -1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.039 0.004
diabetes mellitus -1.300 0.024
interstitial cystitis 1.100 0.008
ulcerative colitis 1.400 0.001

Synonym

Gene

PDB

2IQJ  

Gene RIF (5)

PMID Text
26136365 SMAP2 immunoprecipitated clathrin and AP-1 through a putative clathrin-binding domain and a CALM-binding domain, and SMAP2 mutants that did not interact with clathrin or AP-1 could not localize to recycling endosomes
25281535 Results also demonstrated a physical association between SMAP1 and SMAP2, which might serve as a basis for a functional interaction, and identified the intramolecular domains responsible for this association
21147065 In the current study, there were identified sequences in the carboxy-terminal region of SMAP2 that are critical for its specific subcellular localization and its specificity for Arf proteins.
20831471 analyses revealed that three common polymorphisms, rs2982510, rs2294752, and rs446738, were putatively associated with the increased susceptibility to AIA
20831471 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNL      1 - 70
DQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDK     71 - 140
WKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQLPRKSSPKSTAPVMDLLGLDAPVACSIANSKTSNTLEKD    141 - 210
LDLLASVPSPSSSGSRKVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQTPQMP    211 - 280
TQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPAGYMGGMQASMMGV    281 - 350
PNGMMTTQQAGYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGNGQAAN    351 - 420
QTLSPQMWK                                                                 421 - 429
//

Text Mined References (22)

PMID Year Title
26136365 2015 Transport of the cholera toxin B-subunit from recycling endosomes to the Golgi requires clathrin and AP-1.
25416956 2014 A proteome-scale map of the human interactome network.
25281535 2014 The Arf GTPase-activating protein SMAP1 promotes transferrin receptor endocytosis and interacts with SMAP2.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
21147065 2011 The carboxy-terminal region of SMAP2 directs subcellular localization as well as Arf protein specificity.
20831471 2010 Putative association of SMAPIL polymorphisms with risk of aspirin intolerance in asthmatics.
More...