Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.24
PubTator Score 0.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.5e-07
Astrocytoma, Pilocytic 3081 1.4e-06
tuberculosis 2010 1.5e-06
glioblastoma 5792 5.5e-04
pancreatic cancer 2398 6.9e-04
pancreatic carcinoma 562 6.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Eye and adnexa disease 18 0.0 1.4

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 1.4e-06
glioblastoma 1.200 5.5e-04
osteosarcoma -2.061 1.5e-07
pancreatic cancer 1.100 6.9e-04
pancreatic carcinoma 1.100 6.9e-04
tuberculosis 1.400 1.5e-06

Gene RIF (1)

AA Sequence

MSASGVLSFTQQGWEQVLAKVKRAVVYLDAACAESLHWGCGSTRLLEAVGGPDCHLREFEPDAIGGGAKQ      1 - 70
PKAVFVLSCLLKGRTVEILRDIICRSHFQYCVVVTTVSHAVHLTANHVPAAAAAEMEGQQPVFEQLEEKL     71 - 140
CEWMGNMNYTAEVFHVPLLLAPVAPHFALTPAFASLFPLLPQDVHLLNSARPDKRKLGSLGDVDSTTLTP    141 - 210
ELLLQIRCLVSGLSSLCEHLGVREECFAVGSLSQVIAADLANYAPAKNRKKTAAGRASVVFVDRTLDLTG    211 - 280
AVGHHGDNLVEKIISALPQLPGHTNDVMVNMIALTALHTEEENYNVVAPGCLSQSSDTTAKALWEALLNT    281 - 350
KHKEAVMEVRRHLVEAASRENLPIKMSMGRVTPGQLMSYIQLFKNNLKALMNHCGLLQLGLATAQTLKHP    351 - 420
QTAKWDNFLAFERLLLQSIGESAMSVVLNQLLPMIKPVTQRTNEDYSPEELLILLIYIYSVTGELTVDKD    421 - 490
LCEAEEKVKKALAQVFCEESGLSPLLQKITDWDSSINLTFHKSKIAVDELFTSLRDIAGARSLLKQFKSV    491 - 560
YVPGNHTHQASYKPLLKQVVEEIFHPERPDSVDIEHMSSGLTDLLKTGFSMFMKVSRPHPSDYPLLILFV    561 - 630
VGGVTVSEVKMVKDLVASLKPGTQVIVLSTRLLKPLNIPELLFATDRLHPDLGF                    631 - 684
//

Text Mined References (8)

PMID Year Title