Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.24
PubTator Score 0.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.100 0.001
osteosarcoma -2.061 0.000
glioblastoma 1.200 0.001
tuberculosis 1.400 0.000
pilocytic astrocytoma 1.400 0.000
pancreatic carcinoma 1.100 0.001

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSASGVLSFTQQGWEQVLAKVKRAVVYLDAACAESLHWGCGSTRLLEAVGGPDCHLREFEPDAIGGGAKQ      1 - 70
PKAVFVLSCLLKGRTVEILRDIICRSHFQYCVVVTTVSHAVHLTANHVPAAAAAEMEGQQPVFEQLEEKL     71 - 140
CEWMGNMNYTAEVFHVPLLLAPVAPHFALTPAFASLFPLLPQDVHLLNSARPDKRKLGSLGDVDSTTLTP    141 - 210
ELLLQIRCLVSGLSSLCEHLGVREECFAVGSLSQVIAADLANYAPAKNRKKTAAGRASVVFVDRTLDLTG    211 - 280
AVGHHGDNLVEKIISALPQLPGHTNDVMVNMIALTALHTEEENYNVVAPGCLSQSSDTTAKALWEALLNT    281 - 350
KHKEAVMEVRRHLVEAASRENLPIKMSMGRVTPGQLMSYIQLFKNNLKALMNHCGLLQLGLATAQTLKHP    351 - 420
QTAKWDNFLAFERLLLQSIGESAMSVVLNQLLPMIKPVTQRTNEDYSPEELLILLIYIYSVTGELTVDKD    421 - 490
LCEAEEKVKKALAQVFCEESGLSPLLQKITDWDSSINLTFHKSKIAVDELFTSLRDIAGARSLLKQFKSV    491 - 560
YVPGNHTHQASYKPLLKQVVEEIFHPERPDSVDIEHMSSGLTDLLKTGFSMFMKVSRPHPSDYPLLILFV    561 - 630
VGGVTVSEVKMVKDLVASLKPGTQVIVLSTRLLKPLNIPELLFATDRLHPDLGF                    631 - 684
//

Text Mined References (8)

PMID Year Title
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21269460 2011 Initial characterization of the human central proteome.
20395239 2010 Genome-wide association identifies ATOH7 as a major gene determining human optic disc size.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.