Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.24
PubTator Score 0.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.53496994666944E-7
pilocytic astrocytoma 3086 1.40606700828275E-6
tuberculosis 1563 1.47557153408309E-6
glioblastoma 5572 5.46199063342972E-4
pancreatic cancer 2300 6.92567427904343E-4
pancreatic carcinoma 567 6.92567427904345E-4
Disease Target Count Z-score Confidence
Eye and adnexa disease 11 0.0 1.0

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.100 0.001
osteosarcoma -2.061 0.000
glioblastoma 1.200 0.001
tuberculosis 1.400 0.000
pilocytic astrocytoma 1.400 0.000
pancreatic carcinoma 1.100 0.001

Synonym

Accession Q8WU76 Q8N5F3 Q8N8H0 Q96ED3
Symbols STXBP1L1

Gene

  Ortholog (9)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSASGVLSFTQQGWEQVLAKVKRAVVYLDAACAESLHWGCGSTRLLEAVGGPDCHLREFEPDAIGGGAKQ      1 - 70
PKAVFVLSCLLKGRTVEILRDIICRSHFQYCVVVTTVSHAVHLTANHVPAAAAAEMEGQQPVFEQLEEKL     71 - 140
CEWMGNMNYTAEVFHVPLLLAPVAPHFALTPAFASLFPLLPQDVHLLNSARPDKRKLGSLGDVDSTTLTP    141 - 210
ELLLQIRCLVSGLSSLCEHLGVREECFAVGSLSQVIAADLANYAPAKNRKKTAAGRASVVFVDRTLDLTG    211 - 280
AVGHHGDNLVEKIISALPQLPGHTNDVMVNMIALTALHTEEENYNVVAPGCLSQSSDTTAKALWEALLNT    281 - 350
KHKEAVMEVRRHLVEAASRENLPIKMSMGRVTPGQLMSYIQLFKNNLKALMNHCGLLQLGLATAQTLKHP    351 - 420
QTAKWDNFLAFERLLLQSIGESAMSVVLNQLLPMIKPVTQRTNEDYSPEELLILLIYIYSVTGELTVDKD    421 - 490
LCEAEEKVKKALAQVFCEESGLSPLLQKITDWDSSINLTFHKSKIAVDELFTSLRDIAGARSLLKQFKSV    491 - 560
YVPGNHTHQASYKPLLKQVVEEIFHPERPDSVDIEHMSSGLTDLLKTGFSMFMKVSRPHPSDYPLLILFV    561 - 630
VGGVTVSEVKMVKDLVASLKPGTQVIVLSTRLLKPLNIPELLFATDRLHPDLGF                    631 - 684
//

Text Mined References (8)

PMID Year Title
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21269460 2011 Initial characterization of the human central proteome.
20395239 2010 Genome-wide association identifies ATOH7 as a major gene determining human optic disc size.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.