Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.38
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.300 0.000
psoriasis -1.900 0.000

Gene RIF (2)

PMID Text
22678063 TSPEAR, cause disorders with auditory features: epilepsy, which can include auditory features in humans; audiogenic seizures in animals; and/or hearing impairments in humans and mice.
20494980 The TSPEAR/C21orf29 promoter is activated by Trichostatin A (TSA) treatment according to promoter reporter assays in HEK 293 cells.

AA Sequence

MSALLSLCFVLPLAAPGHGTQGWEPCTDLRPLDILAEVVPSDGATSGIRIVQVHGARGLQLSVAAPRTMS      1 - 70
FPASRIFSQCDLFPEEFSIVVTLRVPNLPPKRNEYLLTVVAEESDLLLLGLRLSPAQLHFLFLREDTAGA     71 - 140
WQTRVSFRSPALVDGRWHTLVLAVSAGVFSLTTDCGLPVDIMADVPFPATLSVKGARFFVGSRRRAKGLF    141 - 210
MGLVRQLVLLPGSDATPRLCPSRNAPLAVLSIPRVLQALTGKPEDNEVLKYPYETNIRVTLGPQPPCTEV    211 - 280
EDAQFWFDASRKGLYLCVGNEWVSVLAAKERLDYVEEHQNLSTNSETLGIEVFRIPQVGLFVATANRKAT    281 - 350
SAVYKWTEEKFVSYQNIPTHQAQAWRHFTIGKKIFLAVANFEPDEKGQEFSVIYKWSHRKLKFTPYQSIA    351 - 420
THSARDWEAFEVDGEHFLAVANHREGDNHNIDSVIYKWNPATRLFEANQTIATSGAYDWEFFSVGPYSFL    421 - 490
VVANTFNGTSTKVHSHLYIRLLGSFQLFQSFPTFGAADWEVFQIGERIFLAVANSHSYDVEMQVQNDSYV    491 - 560
INSVIYELNVTAQAFVKFQDILTCSALDWEFFSVGEDYFLVVANSFDGRTFSVNSIIYRWQGYEGFVAVH    561 - 630
SLPTVGCRDWEAFSTTAGAYLIYSSAKEPLSRVLRLRTR                                   631 - 669
//

Text Mined References (7)

PMID Year Title
22678063 2012 Defect in the gene encoding the EAR/EPTP domain-containing protein TSPEAR causes DFNB98 profound deafness.
20494980 2010 Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12095917 2002 A common protein interaction domain links two recently identified epilepsy genes.
10830953 2000 The DNA sequence of human chromosome 21.