Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.32
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
DEAFNESS, AUTOSOMAL RECESSIVE 98 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.0e-50
lung carcinoma 2843 1.3e-29
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.300 1.3e-29
psoriasis -1.900 1.0e-50

Gene RIF (4)

AA Sequence

MSALLSLCFVLPLAAPGHGTQGWEPCTDLRPLDILAEVVPSDGATSGIRIVQVHGARGLQLSVAAPRTMS      1 - 70
FPASRIFSQCDLFPEEFSIVVTLRVPNLPPKRNEYLLTVVAEESDLLLLGLRLSPAQLHFLFLREDTAGA     71 - 140
WQTRVSFRSPALVDGRWHTLVLAVSAGVFSLTTDCGLPVDIMADVPFPATLSVKGARFFVGSRRRAKGLF    141 - 210
MGLVRQLVLLPGSDATPRLCPSRNAPLAVLSIPRVLQALTGKPEDNEVLKYPYETNIRVTLGPQPPCTEV    211 - 280
EDAQFWFDASRKGLYLCVGNEWVSVLAAKERLDYVEEHQNLSTNSETLGIEVFRIPQVGLFVATANRKAT    281 - 350
SAVYKWTEEKFVSYQNIPTHQAQAWRHFTIGKKIFLAVANFEPDEKGQEFSVIYKWSHRKLKFTPYQSIA    351 - 420
THSARDWEAFEVDGEHFLAVANHREGDNHNIDSVIYKWNPATRLFEANQTIATSGAYDWEFFSVGPYSFL    421 - 490
VVANTFNGTSTKVHSHLYIRLLGSFQLFQSFPTFGAADWEVFQIGERIFLAVANSHSYDVEMQVQNDSYV    491 - 560
INSVIYELNVTAQAFVKFQDILTCSALDWEFFSVGEDYFLVVANSFDGRTFSVNSIIYRWQGYEGFVAVH    561 - 630
SLPTVGCRDWEAFSTTAGAYLIYSSAKEPLSRVLRLRTR                                   631 - 669
//

Text Mined References (9)

PMID Year Title