Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 5.7e-07
medulloblastoma, large-cell 6241 2.1e-04
osteosarcoma 7950 6.6e-04
lung cancer 4740 2.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 5.7e-07
lung cancer 1.100 2.1e-03
medulloblastoma, large-cell 1.100 2.1e-04
osteosarcoma -1.205 6.6e-04

Synonym

Accession Q8WU58 Q9H6F3 Q9NVJ4 Q9NXN6
Symbols C17orf63

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MLACLPGPGDLSFQLLSHTQMNTGLQKWDTTQKMRTAHYPTPAELDAYAKKVANNPLTIKIFPNSVKVPQ      1 - 70
RKHVRRTVNGLDTSAQRYSPYPTQAATKAGLLAIVKVPAKSILKDFDGTRARLLPEAIMNPPVAPYATVA     71 - 140
PSTLAHPQAQALARQQALQHAQTLAHAPPQTLQHPQGIPPPQALSHPQSLQQPQGLGHPQPMAQTQGLVH    141 - 210
PQALAHQGLQHPHNPLLHGGRKMPDSDAPPNVTVSTSTIPLSMAATLQHSQPPDLSSIVHQINQFCQTRA    211 - 280
GISTTSVCEGQIANPSPISRSLLINASTRVSTHSVPTPMPSCVVNPMEHTHAATAALPAAGPVNLPTGIS    281 - 350
RVPTGYPSDLKPVTWNQHQLAHLQQMCSEASGTPAPGLTGKHAAGRELAGPGFVGKAPAYPQELCLAQSF    351 - 420
HLKPPLEKPTPSPPVNGMAAPLAYPNGHYFQPLWNNILPTPNSDSSGSQDLAMPFHGGQPTGAPLDCAAA    421 - 490
PGAHYRAGTGGGPVASQNSLMQTVDYLSGDFQQACFREQSLAMLSKAHRAPGNRAPDPTESRSLHIQHPG    491 - 560
YR                                                                        561 - 562
//

Text Mined References (7)

PMID Year Title