Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 6.0e-07
Disease Target Count Z-score Confidence
Retinitis pigmentosa 4 38 4.276 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.030 6.0e-07

Synonym

Accession Q8WU43
Symbols

Gene

 GO Function (1)

AA Sequence

MSSTLGKLSNQVEETLPLLKKVPANYFHICSAILMGFSLSKSATQVSAIHMDSKVDDHLIRGTEKSRLEP      1 - 70
ATQLFQNTKKIRLEDTNQENFTRIEGTGTGSLSGKALGSVVYVKESDGLEMTDVE                    71 - 125
//

Text Mined References (5)

PMID Year Title