Property Summary

NCBI Gene PubMed Count 59
Grant Count 85
R01 Count 60
Funding $13,170,737.69
PubMed Score 203.34
PubTator Score 72.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.200 0.003
ependymoma 1.400 0.014
osteosarcoma 1.962 0.006
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.100 0.001
medulloblastoma, large-cell -1.600 0.003
ovarian cancer -1.400 0.000

Synonym

Accession Q8WU20 B0LPF2 B2R684 O43558 Q7LDQ6 FGFR substrate 2
Symbols SNT
SNT1
FRS1A
FRS2A
SNT-1
FRS2alpha

Gene

PDB

1XR0   2MFQ  

Gene RIF (22)

PMID Text
26096936 They also demonstrate the potential of overexpressed FRS2alpha as a biomarker for prostate cancer diagnosis, prognosis and response to therapies.
25900027 Increased expression of FRS2alpha (and FGFR1) was associated with decreased progression-free survival among patients with metastatic renal cell carcinoma treated with sorafenib.
25368431 Results identify FRS2 as an oncogene in a subset of high-grade serous ovarian cancers that harbor FRS2 amplifications.
24706887 The docking protein FRS2alpha is a critical regulator of VEGF receptors signaling.
24284065 These results establish the Frs2alpha-Shp2 complex as the key mediator of FGF signaling in lens development.
23393200 Data indicate that the FGFR/FRS2 signaling axis was generally activated in about 75% of FRS2-positive high-grade liposarcomas.
22235335 a novel signaling network containing FRS2, CAP and flotillin-1
22151832 Patient with pigmentation disorders and vitiligo show decreased expression of mRNA.
21793095 Validated FRS2 amplification in both Well-differentiated liposarcoma and dedifferentiated liposarcoma.
21233699 Microdeformations produced by the combination of polyurethane foam and suction are associated with increased fibroblast proliferation and up-regulation of gene expressions in fibroblasts
More...

AA Sequence

MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSN      1 - 70
LFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPG     71 - 140
FAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGEESTHPLLVAEEQVHTYVNTTGVQEERKNRT    141 - 210
SVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSG    211 - 280
ANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYE    281 - 350
NLPSLPPVWEARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVF    351 - 420
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALP    421 - 490
RDDGTSRKTRHNSTDLPM                                                        491 - 508
//

Text Mined References (68)

PMID Year Title
26096936 2016 Hyperactivated FRS2?-mediated signaling in prostate cancer cells promotes tumor angiogenesis and predicts poor clinical outcome of patients.
25900027 2015 The impact of FGFR1 and FRS2? expression on sorafenib treatment in metastatic renal cell carcinoma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25368431 2015 The Tyrosine Kinase Adaptor Protein FRS2 Is Oncogenic and Amplified in High-Grade Serous Ovarian Cancer.
24706887 2014 The docking protein FRS2? is a critical regulator of VEGF receptors signaling.
24284065 2014 Frs2? and Shp2 signal independently of Gab to mediate FGF signaling in lens development.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23393200 2013 Amplification of FRS2 and activation of FGFR/FRS2 signaling pathway in high-grade liposarcoma.
More...