Property Summary

NCBI Gene PubMed Count 61
PubMed Score 224.02
PubTator Score 72.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.200 3.4e-03
atypical teratoid / rhabdoid tumor 1.100 8.5e-06
ependymoma 1.400 1.4e-02
glioblastoma 1.100 1.4e-03
medulloblastoma, large-cell -1.600 2.7e-03
osteosarcoma 1.962 6.2e-03
ovarian cancer -1.400 8.9e-07

Protein-protein Interaction (1)

Gene RIF (23)

AA Sequence

MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSN      1 - 70
LFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPG     71 - 140
FAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGEESTHPLLVAEEQVHTYVNTTGVQEERKNRT    141 - 210
SVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSG    211 - 280
ANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYE    281 - 350
NLPSLPPVWEARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVF    351 - 420
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALP    421 - 490
RDDGTSRKTRHNSTDLPM                                                        491 - 508
//

Text Mined References (70)

PMID Year Title