Property Summary

NCBI Gene PubMed Count 16
Grant Count 7
R01 Count 6
Funding $501,564.23
PubMed Score 14.86
PubTator Score 16.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.432 0.005
tuberculosis and treatment for 6 months 1.400 0.000
ovarian cancer 1.200 0.009

Gene RIF (7)

PMID Text
26210183 TRC8 and TMEM129 are endoplasmic reticulum-associated degradation ubiquitin E3 ligases for viral and cellular targeting of MHC class I. (Review)
22689053 TRC8 suppresses tumorigenesis through targeting heme oxygenase-1 for ubiquitination and degradation.
20068067 TRC8 function may provide a regulatory link between the lipid and protein biosynthetic pathways.
19720873 Data show that the TRC8 E3 ligase is required for MHC I dislocation from the ER and identify a new complex associated with mammalian ERAD.
19706601 TRC8 is a novel sterol-sensing endoplasmic reticulum membrane protein that hinders SREBP-2 processing through interaction with SREBP-2 and SCAP, regulating its own turnover rate by means of its E3 ubiquitin ligase activity
17539022 The presence of diploid and tetraploid tumor cells with and without TRC8 deletions on the nontranslocated chromosome suggest that loss of the remaining normal allele of TRC8 may contribute to tumor development at later stages.
17016439 TRC8 modulation of sterol response element binding protein activity comprises a novel regulatory link between growth control and the cholesterol/lipid homeostasis pathway.

AA Sequence

MAAVGPPQQQVRMAHQQVWAALEVALRVPCLYIIDAIFNSYPDSSQSRFCIVLQIFLRLFGVFASSIVLI      1 - 70
LSQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPRKGPSLWMALIVLQLTFGIG     71 - 140
YVTLLQIHSIYSQLIILDLLVPVIGLITELPLHIRETLLFTSSLILTLNTVFVLAVKLKWFYYSTRYVYL    141 - 210
LVRHMYRIYGLQLLMEDTWKRIRFPDILRVFWLTRVTAQATVLMYILRMANETDSFFISWDDFWDLICNL    211 - 280
IISGCDSTLTVLGMSAVISSVAHYLGLGILAFIGSTEEDDRRLGFVAPVLFFILALQTGLSGLRPEERLI    281 - 350
RLSRNMCLLLTAVLHFIHGMTDPVLMSLSASHVSSFRRHFPVLFVSACLFILPVLLSYVLWHHYALNTWL    351 - 420
FAVTAFCVELCLKVIVSLTVYTLFMIDGYYNVLWEKLDDYVYYVRSTGSIIEFIFGVVMFGNGAYTMMFE    421 - 490
SGSKIRAFMMCLHAYFNIYLQAKNGWKTFMNRRTAVKKINSLPEIKGSRLQEINDVCAICYHEFTTSARI    491 - 560
TPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELN    561 - 630
EDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD                                        631 - 664
//

Text Mined References (25)

PMID Year Title
26210183 2015 Identifying the ERAD ubiquitin E3 ligases for viral and cellular targeting of MHC class I.
25239945 2014 Signal peptide peptidase functions in ERAD to cleave the unfolded protein response regulator XBP1u.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22689053 2013 TRC8 suppresses tumorigenesis through targeting heme oxygenase-1 for ubiquitination and degradation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20068067 2010 The TRC8 ubiquitin ligase is sterol regulated and interacts with lipid and protein biosynthetic pathways.
19720873 2009 The TRC8 E3 ligase ubiquitinates MHC class I molecules before dislocation from the ER.
More...