Property Summary

NCBI Gene PubMed Count 17
PubMed Score 16.62
PubTator Score 16.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.432 4.7e-03
ovarian cancer 1.200 9.1e-03
tuberculosis and treatment for 6 months 1.400 1.9e-06

Gene RIF (8)

AA Sequence

MAAVGPPQQQVRMAHQQVWAALEVALRVPCLYIIDAIFNSYPDSSQSRFCIVLQIFLRLFGVFASSIVLI      1 - 70
LSQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPRKGPSLWMALIVLQLTFGIG     71 - 140
YVTLLQIHSIYSQLIILDLLVPVIGLITELPLHIRETLLFTSSLILTLNTVFVLAVKLKWFYYSTRYVYL    141 - 210
LVRHMYRIYGLQLLMEDTWKRIRFPDILRVFWLTRVTAQATVLMYILRMANETDSFFISWDDFWDLICNL    211 - 280
IISGCDSTLTVLGMSAVISSVAHYLGLGILAFIGSTEEDDRRLGFVAPVLFFILALQTGLSGLRPEERLI    281 - 350
RLSRNMCLLLTAVLHFIHGMTDPVLMSLSASHVSSFRRHFPVLFVSACLFILPVLLSYVLWHHYALNTWL    351 - 420
FAVTAFCVELCLKVIVSLTVYTLFMIDGYYNVLWEKLDDYVYYVRSTGSIIEFIFGVVMFGNGAYTMMFE    421 - 490
SGSKIRAFMMCLHAYFNIYLQAKNGWKTFMNRRTAVKKINSLPEIKGSRLQEINDVCAICYHEFTTSARI    491 - 560
TPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELN    561 - 630
EDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD                                        631 - 664
//

Text Mined References (26)

PMID Year Title