Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Myofibrillar Myopathy 9 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 6.8e-07
Pick disease 1894 7.3e-05
psoriasis 6694 8.7e-05
diabetes mellitus 1728 2.2e-03
progressive supranuclear palsy 676 1.6e-02
astrocytic glioma 2597 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Myopathy 185 0.0 4.0

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.200 3.9e-02
diabetes mellitus -1.200 2.2e-03
osteosarcoma -2.321 6.8e-07
Pick disease -1.600 7.3e-05
progressive supranuclear palsy -1.800 1.6e-02
psoriasis -2.000 8.7e-05

Gene RIF (2)

AA Sequence

MEAARPPPTAGKFVVVGGGIAGVTCAEQLATHFPSEDILLVTASPVIKAVTNFKQISKILEEFDVEEQSS      1 - 70
TMLGKRFPNIKVIESGVKQLKSEEHCIVTEDGNQHVYKKLCLCAGAKPKLICEGNPYVLGIRDTDSAQEF     71 - 140
QKQLTKAKRIMIIGNGGIALELVYEIEGCEVIWAIKDKAIGNTFFDAGAAEFLTSKLIAEKSEAKIAHKR    141 - 210
TRYTTEGRKKEARSKSKADNVGSALGPDWHEGLNLKGTKEFSHKIHLETMCEVKKIYLQDEFRILKKKSF    211 - 280
TFPRDHKSVTADTEMWPVYVELTNEKIYGCDFIVSATGVTPNVEPFLHGNSFDLGEDGGLKVDDHMHTSL    281 - 350
PDIYAAGDICTTSWQLSPVWQQMRLWTQARQMGWYAAKCMAAASSGDSIDMDFSFELFAHVTKFFNYKVV    351 - 420
LLGKYNAQGLGSDHELMLRCTKGREYIKVVMQNGRMMGAVLIGETDLEETFENLILNQMNLSSYGEDLLD    421 - 490
PNIDIEDYFD                                                                491 - 500
//

Text Mined References (13)

PMID Year Title