Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.42
PubTator Score 0.13

Knowledge Summary

Patent (562)

Expression

  Differential Expression (7)

Disease log2 FC p
oligodendroglioma 1.300 0.020
medulloblastoma, large-cell -1.100 0.028
lung adenocarcinoma 1.400 0.000
pilocytic astrocytoma 1.700 0.000
lung carcinoma 2.900 0.000
non-small cell lung carcinoma 1.300 0.000
psoriasis -1.200 0.000

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19845895 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKCVERNEVRNVFK      1 - 70
ELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFKEETVKLFICELVMALDYLQNQ     71 - 140
RIIHRDMKPDNILLDEHGHVHITDFNIAAMLPRETQITTMAGTKPYMAPEMFSSRKGAGYSFAVDWWSLG    141 - 210
VTAYELLRGRRPYHIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPY    211 - 280
MNDINWDAVFQKRLIPGFIPNKGRLNCDPTFELEEMILESKPLHKKKKRLAKKEKDMRKCDSSQTCLLQE    281 - 350
HLDSVQKEFIIFNREKVNRDFNKRQPNLALEQTKDPQGEDGQNNNL                            351 - 396
//

Text Mined References (11)

PMID Year Title
25043870 2014 Cell-free identification of novel N-myristoylated proteins from complementary DNA resources using bioorthogonal myristic acid analogues.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19845895 2009 Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...