Property Summary

Ligand Count 2
NCBI Gene PubMed Count 9
PubMed Score 1.49
PubTator Score 0.13

Knowledge Summary

Patent (562)

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.200 4.8e-27
Astrocytoma, Pilocytic 1.700 3.0e-05
lung adenocarcinoma 1.400 4.5e-07
lung carcinoma 2.900 1.1e-32
medulloblastoma, large-cell -1.100 2.8e-02
non-small cell lung carcinoma 1.300 1.3e-10
oligodendroglioma 1.300 2.0e-02

Gene RIF (2)

AA Sequence

MGANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKCVERNEVRNVFK      1 - 70
ELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFKEETVKLFICELVMALDYLQNQ     71 - 140
RIIHRDMKPDNILLDEHGHVHITDFNIAAMLPRETQITTMAGTKPYMAPEMFSSRKGAGYSFAVDWWSLG    141 - 210
VTAYELLRGRRPYHIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPY    211 - 280
MNDINWDAVFQKRLIPGFIPNKGRLNCDPTFELEEMILESKPLHKKKKRLAKKEKDMRKCDSSQTCLLQE    281 - 350
HLDSVQKEFIIFNREKVNRDFNKRQPNLALEQTKDPQGEDGQNNNL                            351 - 396
//

Text Mined References (11)

PMID Year Title