Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.42
PubTator Score 0.13

Knowledge Summary

Patent (562)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.10349013691858E-32
non-small cell lung carcinoma 413 1.2518799601114E-10
lung adenocarcinoma 2714 4.53617953450868E-7
pilocytic astrocytoma 3086 2.99736719674821E-5
oligodendroglioma 2849 0.0200821596045476
medulloblastoma, large-cell 6234 0.0276807307983965
Disease Target Count Z-score Confidence
psoriasis 6685 0.0 1.0

Expression

  Differential Expression (7)

Disease log2 FC p
oligodendroglioma 1.300 0.020
medulloblastoma, large-cell -1.100 0.028
lung adenocarcinoma 1.400 0.000
pilocytic astrocytoma 1.700 0.000
lung carcinoma 2.900 0.000
non-small cell lung carcinoma 1.300 0.000
psoriasis -1.200 0.000

Synonym

Accession Q8WU08 B3KSY0
Symbols YANK1

Gene

PDB

4FR4  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

 Collection (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19845895 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKCVERNEVRNVFK      1 - 70
ELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFKEETVKLFICELVMALDYLQNQ     71 - 140
RIIHRDMKPDNILLDEHGHVHITDFNIAAMLPRETQITTMAGTKPYMAPEMFSSRKGAGYSFAVDWWSLG    141 - 210
VTAYELLRGRRPYHIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPY    211 - 280
MNDINWDAVFQKRLIPGFIPNKGRLNCDPTFELEEMILESKPLHKKKKRLAKKEKDMRKCDSSQTCLLQE    281 - 350
HLDSVQKEFIIFNREKVNRDFNKRQPNLALEQTKDPQGEDGQNNNL                            351 - 396
//

Text Mined References (11)

PMID Year Title
25043870 2014 Cell-free identification of novel N-myristoylated proteins from complementary DNA resources using bioorthogonal myristic acid analogues.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19845895 2009 Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...