Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.11
PubTator Score 4.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
fibroadenoma 559 1.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
fibroadenoma 1.600 1.0e-02

Gene RIF (2)

AA Sequence

MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDH      1 - 70
YTNTYHIFTKAPDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKK     71 - 140
HKTSSNDKMELFEVDDDNKEGNFSNMFLDASHAGLVNEHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQ    141 - 210
LVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICP    211 - 280
CGWHQWKCTPKKYC                                                            281 - 294
//

Text Mined References (6)

PMID Year Title