Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8WTZ4 A6NEZ4
Symbols CA5BL
CA5BP
PRO2325

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MTQPPASTSGIMGTLSSWNLKILQINQLHLVHWNAVKFENFEDAALEENGLAVIGVFLKISETSGSPVST      1 - 70
GRPKPLARKLRPAQKHWVLQSRPFLSSQVQENCKVTYFHRKHWVRIRPLRTTPPSWDYTRICIQREMVPA     71 - 140
RIRVLREMVPEAWRCFPNRLPLLSNIRPDFSKAPLAYVKRWLWTARHPHSLSAAW                   141 - 195
//

Text Mined References (5)

PMID Year Title