Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WTX7 O76052 Q96ND9 Q9UIE8
Symbols GATSL3

Gene

PDB

5GS9   5GT7   5GT8   5GV2   5I2C  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQ      1 - 70
VAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQE     71 - 140
FDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHS    141 - 210
TPKEAASSSPEPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGI    211 - 280
VAQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLAS                         281 - 329
//

Text Mined References (12)

PMID Year Title