Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Rheumatoid Arthritis 1,160

Expression

Gene RIF (3)

PMID Text
27487210 1.8 A crystal structure of arginine-bound CASTOR1
26972053 Study establishes the CASTOR1 homodimer and CASTOR1-CASTOR2 heterodimer as arginine sensors for the mTORC1 pathway.
24449572 This genome wide association study identified a new rheumatoid arthritis susceptibility locus mapping to 22q12 in the GATSL3 gene.

AA Sequence

MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQ      1 - 70
VAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQE     71 - 140
FDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHS    141 - 210
TPKEAASSSPEPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGI    211 - 280
VAQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLAS                         281 - 329
//

Text Mined References (12)

PMID Year Title
27487210 2016 Mechanism of arginine sensing by CASTOR1 upstream of mTORC1.
26972053 2016 The CASTOR Proteins Are Arginine Sensors for the mTORC1 Pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24449572 2014 Novel rheumatoid arthritis susceptibility locus at 22q12 identified in an extended UK genome-wide association study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15998911 2005 Examples of the complex architecture of the human transcriptome revealed by RACE and high-density tiling arrays.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...