Property Summary

Ligand Count 51
NCBI Gene PubMed Count 287
PubMed Score 915.72
PubTator Score 533.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ductal carcinoma in situ -1.500 3.0e-03
group 3 medulloblastoma -1.300 5.5e-04
invasive ductal carcinoma -1.200 7.7e-03
oligodendroglioma 1.200 8.5e-03
ovarian cancer -1.400 5.1e-09
pancreatic ductal adenocarcinoma liver m... -1.615 2.5e-02
subependymal giant cell astrocytoma 1.200 4.4e-02

Gene RIF (266)

AA Sequence

MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFF      1 - 70
DVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNIL     71 - 140
VLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAE    141 - 210
LNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEAC    211 - 280
RSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNA    281 - 350
DPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG    351 - 420
AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQVGAGQRAARADSHSLACWGKGAS    421 - 490
DRTLWPTAAWSPPPAAVLRLCRSGSGHCWGLRSTLASFACRVATTLPVLEGLGPSLGGGTGS            491 - 552
//

Text Mined References (295)

PMID Year Title