Property Summary

NCBI Gene PubMed Count 261
Grant Count 448
R01 Count 331
Funding $64,403,063.14
PubMed Score 869.07
PubTator Score 533.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q8WTV0 F8W8N0 Q14016 Q52LZ5 Q6KFX4 SRB1
Symbols CLA1
SRB1
CLA-1
SR-BI
CD36L1
HDLQTL6

Gene

PANTHER Protein Class (1)

Gene RIF (241)

PMID Text
26965621 SCARB1 P376L is associated specifically with elevated HDL cholesterol level and risk of coronary heart disease.
26936883 hSR-BII, and to a lesser extent hSR-BI, significantly increase LPS-induced inflammation and contribute to LPS-induced tissue injury in the liver and kidney, two major organs susceptible to LPS toxicity.
26754576 the single nucleotide polymorphism (rs5888) within SCARB1 is independently associated with premature coronary artery disease in a sex-dependent manner.
26602218 Intestinal activation of LXR reduces the production of chylomicrons by a mechanism dependent on the apical localization of SR-B1.
26577021 These results suggest that EPA inhibits intestinal beta-carotene absorption by down regulation of SR B1 expression via PPARalpha dependent mechanism and provide an evidence for dietary modulation of intestinal beta-carotene absorption.
26571379 resistance to HCV in HIV+ patients may be related to genetic variation in SCARB1 or OCLN
26563154 Data show consistent association of scavenger receptor class B member 1 (SCARB1) variants with high-density lipoprotein cholesterol (HDL-C) across various association analyses, suggesting the role of SCARB1 in lipoprotein-lipid regulatory mechanism.
26511855 SR-B1 and targeted HDL NPs provide a fundamental advance in studying cholesterol-dependent cellular uptake mechanisms.
26454245 The SR-B1(P297S) mutation affects both HDL and LDL/VLDL protein compositions. The increase of apoE in carriers suggests a compensatory mechanism for attenuated SR-B1 mediated cholesterol uptake by HDL.
26431876 Hepatic SR-BI is associated with type 2 diabetes but unrelated to human and murine non-alcoholic fatty liver disease.
More...

AA Sequence

MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFF      1 - 70
DVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNIL     71 - 140
VLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAE    141 - 210
LNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEAC    211 - 280
RSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNA    281 - 350
DPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG    351 - 420
AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQVGAGQRAARADSHSLACWGKGAS    421 - 490
DRTLWPTAAWSPPPAAVLRLCRSGSGHCWGLRSTLASFACRVATTLPVLEGLGPSLGGGTGS            491 - 552
//

Text Mined References (266)

PMID Year Title
26965621 2016 Rare variant in scavenger receptor BI raises HDL cholesterol and increases risk of coronary heart disease.
26936883 2016 Human SR-BI and SR-BII Potentiate Lipopolysaccharide-Induced Inflammation and Acute Liver and Kidney Injury in Mice.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26754576 2016 The rs5888 single nucleotide polymorphism in scavenger receptor class B type 1 (SCARB1) gene and the risk of premature coronary artery disease: a case-control study.
26602218 2016 Liver X Receptor Regulates Triglyceride Absorption Through Intestinal Down-regulation of Scavenger Receptor Class B, Type 1.
26577021 2016 Eicosapentaenoic acid inhibits intestinal ?-carotene absorption by downregulation of lipid transporter expression via PPAR-? dependent mechanism.
26571379 2015 Identification of Variants of Hepatitis C Virus (HCV) Entry Factors in Patients Highly Exposed to HCV but Remaining Uninfected: An ANRS Case-Control Study.
26563154 2015 Genetic contribution of SCARB1 variants to lipid traits in African Blacks: a candidate gene association study.
26511855 2015 Nanoparticle Targeting and Cholesterol Flux Through Scavenger Receptor Type B-1 Inhibits Cellular Exosome Uptake.
26454245 2015 Lipoprotein profiles in human heterozygote carriers of a functional mutation P297S in scavenger receptor class B1.
More...